Glyma09g41770 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g41770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g41770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g41770

Feature Type:	gene_model
Chromosome:	Gm09
Start:	46442963
stop:	46447848
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g41770

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G39970	AT	Annotation by Michelle Graham. TAIR10: Mitochondrial substrate carrier family protein \| chr2:16684026-16686392 REVERSE LENGTH=331	SoyBase	E_val: 9.00E-111	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0043132	GO-bp	Annotation by Michelle Graham. GO Biological Process: NAD transport	SoyBase	N/A	ISS
GO:0044375	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of peroxisome size	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0005778	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisomal membrane	SoyBase	N/A	ISS
KOG0769	KOG	Predicted mitochondrial carrier protein	JGI		ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF36	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_B7EBN1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: cDNA clone:001-044-E12, full insert sequence n=4 Tax=Oryza RepID=B7EBN1_ORYSJ	SoyBase	E_val: 5.00E-130	ISS
UniRef100_UPI0002339021	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339021 related cluster n=1 Tax=unknown RepID=UPI0002339021	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma09g41770

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g41770 not represented in the dataset	Glyma09g41770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g41770

Paralog	Evidence	Comments
Glyma20g00730	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g41770 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g281200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g41770

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g41770

Limit To All Plant Sequences

>Glyma09g41770.2   sequence type=CDS   gene model=Glyma09g41770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTATTTTTCAATGCTTTCAGGGCATTTACTACTATTTCTATCAAGTTTTTAAGAATAAGGCAGTGACCATTGCAGCTGCGCAGAAAGTGAAAGGGCGTGGAGATGGTACTGTTGGGATGTTTGGTTGGCTTGTTGTGGCTGCAATTGCTGGGTCCCTGAATGTGTTGTTCACAAACCCAATATGGGTTTTGGTGACTCGGATGCAGACTCATACTCAAGCACAAAGGAAAATCATGGAGGAAAAGAAAGAAGCTTTAAGGAAGGCTGCTTCTGAAAGCACCATAGCAGACTCAACATTGCAAGACAAATTGGCTGAACTGAACTCTATAAAACCTCGGCCATATGGAACTATACACGCAGCTAACGAAGTCTACAATGAAGCGGGTATAGTTGGATTTTGGAAGGGAGTCATCCCTGCCCTTATTATGGTATGCAATCCATCAATTCAGTTTATGATTTATGAGAGCTCATTAAAGCATCTAAGGGAAAAACGAGCTGCTAAGAAGCAAGGGAATACAAGTATATCTGCTTTGGAGGTCTTTTTGGTGGGAGCAATAGCGAAACTTGGAGCTACTGTCTCAACATATCCATTACTAGTTGTCAAGTCAAGGCTTCAAGCAAAACAGGAGATTGGTGGAAGTAGCTCATTAAGATACTCAGGTACTTTTGATGCGGTACTTAAAATGATCCGCTATGAAGGATTACCTGGCTTTTATAAGGGGATGAGCACGAAGATAGTACAAAGTGTTTTTGCAGCTTCTGTTCTATTCATGGTTAAGGAGGAGCTTGTTAAGGCTTTTATGGTTCTGGCGGATAAGAGCAAAAAAGTTGTATCAAATATAAGTAGTTGA

Predicted protein sequences of Glyma09g41770

Limit To All Plant Sequences

>Glyma09g41770.2   sequence type=predicted peptide   gene model=Glyma09g41770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLIFQCFQGIYYYFYQVFKNKAVTIAAAQKVKGRGDGTVGMFGWLVVAAIAGSLNVLFTNPIWVLVTRMQTHTQAQRKIMEEKKEALRKAASESTIADSTLQDKLAELNSIKPRPYGTIHAANEVYNEAGIVGFWKGVIPALIMVCNPSIQFMIYESSLKHLREKRAAKKQGNTSISALEVFLVGAIAKLGATVSTYPLLVVKSRLQAKQEIGGSSSLRYSGTFDAVLKMIRYEGLPGFYKGMSTKIVQSVFAASVLFMVKEELVKAFMVLADKSKKVVSNISS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain