SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g41370

Feature Type:gene_model
Chromosome:Gm09
Start:46071896
stop:46073185
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g41370
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38370AT Annotation by Michelle Graham. TAIR10: Plant protein of unknown function (DUF827) | chr2:16072184-16074168 REVERSE LENGTH=522 SoyBaseE_val: 3.00E-75ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016571GO-bp Annotation by Michelle Graham. GO Biological Process: histone methylation SoyBaseN/AISS
GO:0016579GO-bp Annotation by Michelle Graham. GO Biological Process: protein deubiquitination SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05701PFAM Plant protein of unknown function (DUF827) JGI ISS
UniRef100_I1L734UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1L734_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q10LQ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=2 Tax=Oryza sativa RepID=Q10LQ3_ORYSJ SoyBaseE_val: 8.00E-69ISS

Expression Patterns of Glyma09g41370
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g41370
ParalogEvidenceComments
Glyma18g44410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma19g28840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g41370 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g277300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g41370
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g41370
>Glyma09g41370.1   sequence type=CDS   gene model=Glyma09g41370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAAATGTGATAAAAAATCAGTTGTTGATGAGAATGAAGAAAAGGAAAACCAAGTGAATCAATTGAATGTTCTTCAACCTTCCAGGGAAGGTTTTATCCCCTACCCTTCGTCTACTCCTGGGTTGATACTAATGAAATTGAAGCAGGCCAAATTGAATTTAACTAAAACTACTAATGACCTTGCTGACGTCCGAACTTCTGTTGAATCGCTTAATAAGAGGTTAGAGAAGGAAAGAATCTCACTTAAGAAAACATGTGAGAGGTTAGCTCAAAATACTTCAAAGATATCTTCTCTTGAGGAAGAGCTAAACCAAACCAGATTAAGGCTGCAAATAGCAAAAGATGCTGAAATTAAAGGTGCTCTAGATGACCCTTTAGATATTACAAGAGAGCTCCAGCGATTGAGTTATGAGGCAAAGAATTTCAAAAGAATGGGAGAATCTGCGAAATCAAAAGTTTTGAGGACAATGTCTGAGATTGAACAGACAAAAACGATGTTAAGAACTACTGAGATCAGATTGGTTGCGGCCAGAAAAATGAAAGAAGCTGCTAGAGCTGTCGAAGCTTTTGCCCTTGCAGAAATTAATGTTGTATCTAATCATGACAGTTCACCAGGAAATCAGGTTACTCTTTCATTTGAAAAGTATACTGCTTTGACGTGCAAAGCTCGAGATTCAGAGGAACAATCCAAGAAGAGAGTTGCAAGTGCTATGCTTGAAGTTGACGAAACAAATTTGTCAAACATGGACATTTTGAAAAGGGTAGAAGAAGCTACAGAAGAAGTTAAAACCAGCAAGAAGGCCCTTGAAGAAGCTCTAGAAAGGGTAGAAGCTGCGAATAGAGACAAAGTAGCAGTTGAAGAGGCTTTAAGGAATTGGCGATCTGAGGGTCAAAAAAGACGTTCTTCTATACACAACTCTACCAAGTTCAAAAACTGTTGTTTGTCTCATCATTGGAGAGATCCTCAATTACTTGATGTGAATGGATTGCATCTGGTAAATGATGAAGCAAAGCCAGTAAAGCCAACCCTATCAATAGGACAAATACTTAGCAGGAAGCTGCTTCAACCACAAAAATTTGAAGCCGGAGAAGGAATCTCGATGAAACAGAATGTGTCACTGGGTCAGATGTTTGGTAAACAGAACAATGATCGACCAATTGATAGACAAGTTGAGAAAGAAACTGGCCATAAGTTGTTTTCTACCAAGAGCCAGAAATTTGGATTTGCACGATTCTCGCATATTTTGTCAAAACAGAAGAAGAAGCCAACCCTGAATTTGAGGTGA
Predicted protein sequences of Glyma09g41370
>Glyma09g41370.1   sequence type=predicted peptide   gene model=Glyma09g41370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKCDKKSVVDENEEKENQVNQLNVLQPSREGFIPYPSSTPGLILMKLKQAKLNLTKTTNDLADVRTSVESLNKRLEKERISLKKTCERLAQNTSKISSLEEELNQTRLRLQIAKDAEIKGALDDPLDITRELQRLSYEAKNFKRMGESAKSKVLRTMSEIEQTKTMLRTTEIRLVAARKMKEAARAVEAFALAEINVVSNHDSSPGNQVTLSFEKYTALTCKARDSEEQSKKRVASAMLEVDETNLSNMDILKRVEEATEEVKTSKKALEEALERVEAANRDKVAVEEALRNWRSEGQKRRSSIHNSTKFKNCCLSHHWRDPQLLDVNGLHLVNDEAKPVKPTLSIGQILSRKLLQPQKFEAGEGISMKQNVSLGQMFGKQNNDRPIDRQVEKETGHKLFSTKSQKFGFARFSHILSKQKKKPTLNLR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo