SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma09g41275

Feature Type:gene_model
Chromosome:Gm09
Start:45967919
stop:45969087
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38500AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr2:16117610-16119041 REVERSE LENGTH=356 SoyBaseE_val: 4.00E-19ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N3A1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N3A1_SOYBN SoyBaseE_val: 1.00E-62ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g41275 not represented in the dataset

Glyma09g41275 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g44770 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g41275.1   sequence type=CDS   gene model=Glyma09g41275   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCACTGCATATTTTACGTCCAAACTGAAAGAGGTCCCCTATCATTTGACGCAGGTCCAGAGAACATAGTTGTCACCGTTGGCAAACAGCTAGAGGGGTGGAGCCATGGTGTATTCAAATGTGTTCCTGGGGAAATGATCTTCATGCCGAGTTTCCAGAGTAGCCCTGCCTCTTTCTCCATAGAGCTTGTGTGCTTGGCCTCTTCGAATGATCTAAGTCACAGTTTAAACAATTCTGACGACTGTGACAACATAATATCCTTGGCGGATCAAATCATTGTTGTATTTTGTCTTATATTTTTATACTTCGTTTTTTCCTGA

>Glyma09g41275.1   sequence type=predicted peptide   gene model=Glyma09g41275   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEHCIFYVQTERGPLSFDAGPENIVVTVGKQLEGWSHGVFKCVPGEMIFMPSFQSSPASFSIELVCLASSNDLSHSLNNSDDCDNIISLADQIIVVFCLIFLYFVFS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo