Glyma09g41275 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g41275

Feature Type:	gene_model
Chromosome:	Gm09
Start:	45967919
stop:	45969087
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g41275

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38500	AT	Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein \| chr2:16117610-16119041 REVERSE LENGTH=356	SoyBase	E_val: 4.00E-19	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1N3A1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N3A1_SOYBN	SoyBase	E_val: 1.00E-62	ISS

Expression Patterns of Glyma09g41275

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g41275 not represented in the dataset	Glyma09g41275 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g41275

Paralog	Evidence	Comments
Glyma18g44770	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g41275 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma09g41275

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g41275

Limit To All Plant Sequences

>Glyma09g41275.1   sequence type=CDS   gene model=Glyma09g41275   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCACTGCATATTTTACGTCCAAACTGAAAGAGGTCCCCTATCATTTGACGCAGGTCCAGAGAACATAGTTGTCACCGTTGGCAAACAGCTAGAGGGGTGGAGCCATGGTGTATTCAAATGTGTTCCTGGGGAAATGATCTTCATGCCGAGTTTCCAGAGTAGCCCTGCCTCTTTCTCCATAGAGCTTGTGTGCTTGGCCTCTTCGAATGATCTAAGTCACAGTTTAAACAATTCTGACGACTGTGACAACATAATATCCTTGGCGGATCAAATCATTGTTGTATTTTGTCTTATATTTTTATACTTCGTTTTTTCCTGA

Predicted protein sequences of Glyma09g41275

Limit To All Plant Sequences

>Glyma09g41275.1   sequence type=predicted peptide   gene model=Glyma09g41275   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEHCIFYVQTERGPLSFDAGPENIVVTVGKQLEGWSHGVFKCVPGEMIFMPSFQSSPASFSIELVCLASSNDLSHSLNNSDDCDNIISLADQIIVVFCLIFLYFVFS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain