SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g41260

Feature Type:gene_model
Chromosome:Gm09
Start:45958384
stop:45961674
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g41260
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G51610AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to oxidative stress; LOCATED IN: endomembrane system; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15 growth stages; Has 53 Blast hits to 53 proteins in 21 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 48; Viruses - 0; Other Eukaryotes - 5 (source: NCBI BLink). | chr3:19139715-19141986 REVERSE LENGTH=230 SoyBaseE_val: 4.00E-93ISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1L719UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L719_SOYBN SoyBaseE_val: 7.00E-124ISS

Expression Patterns of Glyma09g41260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g41260
ParalogEvidenceComments
Glyma18g44750 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g41260 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g276200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g41260
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g41260
>Glyma09g41260.1   sequence type=CDS   gene model=Glyma09g41260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCAGCAGCCACCGCGAAACCGCTTCTGTCACTGTGGTTTATGCTTCTGCTACCGTCGTTTCTTCGGATCGCCGTCGCTTACCGACCCGGCGACATCGTTCCCATGAGCTGCATGGGTCAATACCACTCCTCGCGAACCGTGTGGCAGGACCTCATTGGCCGCCACTGCCCCATCTTCGCCGTGAATCGCGAGGTGTTGATGCCCATACCCAAGCCCACGGGTTACACTGGTGCTGATGCTTATAAAATATTGTTTCAAGTTGGAAGGGAAAAGTTTTTAATCCCGTGGCTTCTTGTGGTGAATCGGAAAAGTACAGAGGTTCCAATGATCGAAGTAGATCTGAGGTATTCAGGAAATGATTTGCATGGTGTCACAGCTAAAGTTGTGGATATGCCTCATCACTATGTTGAAGTTCATCCTGAGATTAGTAAACAATTCTGGGATTCTCAGCATTGGCCAAAGCATATACTCGTCCGATATACATGGAAAGAACATTCAGAGATAGATGTAACTTCAGGATTTTTTGTTCTGTTTGGTTCAGGTAAATAA
Predicted protein sequences of Glyma09g41260
>Glyma09g41260.1   sequence type=predicted peptide   gene model=Glyma09g41260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAAATAKPLLSLWFMLLLPSFLRIAVAYRPGDIVPMSCMGQYHSSRTVWQDLIGRHCPIFAVNREVLMPIPKPTGYTGADAYKILFQVGREKFLIPWLLVVNRKSTEVPMIEVDLRYSGNDLHGVTAKVVDMPHHYVEVHPEISKQFWDSQHWPKHILVRYTWKEHSEIDVTSGFFVLFGSGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo