Glyma09g41150 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g41150

Feature Type:	gene_model
Chromosome:	Gm09
Start:	45876427
stop:	45880057
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g41150

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G08740	AT	Annotation by Michelle Graham. TAIR10: elongation factor P (EF-P) family protein \| chr3:2654788-2656154 REVERSE LENGTH=236	SoyBase	E_val: 4.00E-108	ISS
GO:0006414	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational elongation	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0016226	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly	SoyBase	N/A	ISS
GO:0043043	GO-bp	Annotation by Michelle Graham. GO Biological Process: peptide biosynthetic process	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003746	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity	SoyBase	N/A	ISS
PF01132	PFAM	Elongation factor P (EF-P) OB domain	JGI		ISS
PF08207	PFAM	Elongation factor P (EF-P) KOW-like domain	JGI		ISS
PF09285	PFAM	Elongation factor P, C-terminal	JGI		ISS
UniRef100_G7KY52	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Elongation factor P n=1 Tax=Medicago truncatula RepID=G7KY52_MEDTR	SoyBase	E_val: 1.00E-111	ISS
UniRef100_I1L709	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L709_SOYBN	SoyBase	E_val: 3.00E-172	ISS

Expression Patterns of Glyma09g41150

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g41150

Paralog	Evidence	Comments
Glyma18g44620	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g41150 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g275000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g41150

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g41150

Limit To All Plant Sequences

>Glyma09g41150.1   sequence type=CDS   gene model=Glyma09g41150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGCGGGAACTGCAACCTTGAAGCTTAATCTCTCCGATTTTTCTTCTCCAATGTCAAGTTTCAGCGCTTCTTCCTCTTCTTCTTCATTCCCCTTTCTTCTTTCAATGCGAACCCCTTCTTCTTCTTCTAAACCCCGATTTCTCAGGATTTACGCCTTGACCAGCAACGACATCAAGGTCGGCACCAACCTCGAAGTCGATGGTGCTCCTTGGCGCGTGTTAGAGTTTCTTCACGTTAAGCCGGGAAAAGGCGCGGCGTTTGTGAGGACCAAGATGAAGAATTATATTACAGGGAACACGGTGGAGAAAACGTTTAGAGCTGGAAGCTCGATTGAGCAAGCAGATGTATTCAAAGAAACAAAGCAGTTTACATATAAAGATGGTGTTCAATTTGTCTTCATGGACTTGAATACATATGAGGAGTTTCGTCTGGGTGAAAAGGAAATTGGAGACAGAACAAAATGGCTAAAAGAAGGAATGGACTGTAATTTGCTGTTATGGAATGGAAAAGTTATTGATGTTGAACTCCCTATCACAATCAAGCTTACTGTAGTTGATGTGGATCCAGGACTTAAGGGTGACACGGCCCAAGGCGGAACAAAACCAGCCACCCTCGACACCAGCGCTGTTGTCAATGTCCCACTCTTTGTAAATGTCGGTGATGAAATATTGGTTGATTCAAGAACTGGGCAGTACATGAGCCGTGCTTAA

Predicted protein sequences of Glyma09g41150

Limit To All Plant Sequences

>Glyma09g41150.1   sequence type=predicted peptide   gene model=Glyma09g41150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVAGTATLKLNLSDFSSPMSSFSASSSSSSFPFLLSMRTPSSSSKPRFLRIYALTSNDIKVGTNLEVDGAPWRVLEFLHVKPGKGAAFVRTKMKNYITGNTVEKTFRAGSSIEQADVFKETKQFTYKDGVQFVFMDLNTYEEFRLGEKEIGDRTKWLKEGMDCNLLLWNGKVIDVELPITIKLTVVDVDPGLKGDTAQGGTKPATLDTSAVVNVPLFVNVGDEILVDSRTGQYMSRA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain