Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g41050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g41050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma09g41050
Feature Type: gene_model
Chromosome: Gm09
Start: 45810286
stop: 45812389
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g41050
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G56400 AT
Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 70 | chr3:20909082-20910409 REVERSE LENGTH=294
SoyBase E_val: 1.00E-37 ISS
GO:0000165 GO-bp
Annotation by Michelle Graham. GO Biological Process: MAPK cascade
SoyBase N/A ISS
GO:0001666 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to hypoxia
SoyBase N/A ISS
GO:0002679 GO-bp
Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response
SoyBase N/A ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0006612 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane
SoyBase N/A ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0009595 GO-bp
Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus
SoyBase N/A ISS
GO:0009617 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to bacterium
SoyBase N/A ISS
GO:0009625 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to insect
SoyBase N/A ISS
GO:0009627 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance
SoyBase N/A ISS
GO:0009697 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process
SoyBase N/A ISS
GO:0009751 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus
SoyBase N/A ISS
GO:0009753 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus
SoyBase N/A ISS
GO:0009759 GO-bp
Annotation by Michelle Graham. GO Biological Process: indole glucosinolate biosynthetic process
SoyBase N/A ISS
GO:0009814 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction
SoyBase N/A ISS
GO:0009862 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009863 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009864 GO-bp
Annotation by Michelle Graham. GO Biological Process: induced systemic resistance, jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0010120 GO-bp
Annotation by Michelle Graham. GO Biological Process: camalexin biosynthetic process
SoyBase N/A ISS
GO:0010200 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to chitin
SoyBase N/A ISS
GO:0010310 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process
SoyBase N/A ISS
GO:0010363 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response
SoyBase N/A ISS
GO:0019684 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction
SoyBase N/A ISS
GO:0031347 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of defense response
SoyBase N/A ISS
GO:0031348 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response
SoyBase N/A ISS
GO:0035304 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0043069 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death
SoyBase N/A ISS
GO:0043900 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process
SoyBase N/A ISS
GO:0045088 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of innate immune response
SoyBase N/A ISS
GO:0045892 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0050832 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to fungus
SoyBase N/A ISS
GO:0051707 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to other organism
SoyBase N/A ISS
GO:1900056 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of leaf senescence
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
PF03106 PFAM
WRKY DNA -binding domain
JGI ISS
UniRef100_B0LUS2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor n=1 Tax=Glycine max RepID=B0LUS2_SOYBN
SoyBase E_val: 4.00E-180 ISS
UniRef100_I1L6Z7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6Z7_SOYBN
SoyBase E_val: 0 ISS
Proteins Associated with Glyma09g41050
Locus Gene Symbol Protein Name
WRKY125 WRKY Transcription Factor
Expression Patterns of Glyma09g41050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma09g41050
Paralog Evidence Comments
Glyma18g44560 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma09g41050 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g274000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g41050
Coding sequences of Glyma09g41050
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g41050.1 sequence type=CDS gene model=Glyma09g41050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAAATCTTGGTGGTTCTAGTCGTAGGAAAGCAATTGAGGAGCTTCTTAGAGGGCGTGATTCTGCCCAACAACTTAAGAGTGTCATCAATGGGACTTATGATGATGGATCAGCCACCCCATTTGCTCAACAACTTGTGAAAGAGGTGCTCATGTCCTTCACAAACTCCCTCTTGTTCTTGCACAACAACCCCACTTCTGAATCACATCATGTCTTCAATGTTCAAGTATGGGACTCTCCCAAGTCTGAGGACTCTCAAGAGAGCAATTGCAAAAGCTCCACCATTAAGGAACCAAGAGGGTGCTACAAGAGAAGAAGAACTGAACAAACATGGGAGAAGGAATCTGAAGCTCCAATTGATGACGGCCATCACTGGAGAAAGTATGGCCAAAAGGAGATCCTGAATGCCAAATTCCCTAGGAACTACTATAGGTGCACTCACAAATTTGACCAAGGTTGCCAAGCAACAAAACAGGTGCAAAGAGTTCAAGAGGAACCAATCCTATTCAAAACCACCTACTATGGGCACCATACTTGCAAGAACTCGGCAAACCCTGATATCATACTTGACCCCATGTCCCCTTCATCCTCTTCCAAGTTCCTTAGCTTTGACAACTCCTTTTCAACCCCATCCAAGCAAGAGTGCCCCTTTCTCTCATCTTCCAATAATTTCCCATCATCATCATCAGTGAAAAGGGAGTGCAAGGAGGAGGTCCCTCCCTCAATTTCCTCCAATGATTACCTCATCTCTTCTGACCTCACTTTTGATAGCTCACCAAGGCATCATGTCACTCTATCATCAACACTTGACTCTGAGTACAAGAGTGTGGACATTTCGGATGTCTTGTATGATTCTGCCCAGCTTGATTTTGTCTTTGAACCCTTCCTTGAAATTAGATGA
Predicted protein sequences of Glyma09g41050
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g41050.1 sequence type=predicted peptide gene model=Glyma09g41050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MENLGGSSRRKAIEELLRGRDSAQQLKSVINGTYDDGSATPFAQQLVKEVLMSFTNSLLFLHNNPTSESHHVFNVQVWDSPKSEDSQESNCKSSTIKEPRGCYKRRRTEQTWEKESEAPIDDGHHWRKYGQKEILNAKFPRNYYRCTHKFDQGCQATKQVQRVQEEPILFKTTYYGHHTCKNSANPDIILDPMSPSSSSKFLSFDNSFSTPSKQECPFLSSSNNFPSSSSVKRECKEEVPPSISSNDYLISSDLTFDSSPRHHVTLSSTLDSEYKSVDISDVLYDSAQLDFVFEPFLEIR*