SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g41030

Feature Type:gene_model
Chromosome:Gm09
Start:45790486
stop:45791746
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g41030
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G01910AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 66 Blast hits to 66 proteins in 27 species: Archae - 0; Bacteria - 2; Metazoa - 18; Fungi - 7; Plants - 29; Viruses - 0; Other Eukaryotes - 10 (source: NCBI BLink). | chr5:357950-358655 REVERSE LENGTH=180 SoyBaseE_val: 2.00E-24ISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010389GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle SoyBaseN/AISS
GO:0048451GO-bp Annotation by Michelle Graham. GO Biological Process: petal formation SoyBaseN/AISS
GO:0048453GO-bp Annotation by Michelle Graham. GO Biological Process: sepal formation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1L6Z5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L6Z5_SOYBN SoyBaseE_val: 1.00E-148ISS

Expression Patterns of Glyma09g41030
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g41030
ParalogEvidenceComments
Glyma18g44540 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g41030 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g273800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g41030
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g41030
>Glyma09g41030.1   sequence type=CDS   gene model=Glyma09g41030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAAATGCAAACGCAGATGCTAACTCCGACGACCGGAGTACCGAAGCTCCGGCCGCGATCCGGCCGGACGCCGCTTCAGCTTAAGAACTCTCCGGCCGATCCCATCCAGCCTTCCGCGAAGCTCAAGTCGAAGCCATATTTTGAGATTTCGTTGATCGATAAAGAGAACAATCCGATCGCCGCCGTTGCGGTTCCGCCGGCTGTGCCGCCGGAGACGTCGCTGGCGGAGGAGCTCAGCGCGGTCAAGAAGAAGCTGGAGAGGATGAGGGCGGACAAGGAGAGAACGGAGAAAATACTGAACGAGAAACACGCGCTGCTGGACGCGTGGATGAAGGAGATGGAAGAGCGAGGGGAGAATCAGAAGAACTTCGAGATAGAGGTTGACCGGTTGTTCCGGTTGAAGGAACTCAAGTATCGCTGCATGAGAGTTTCTCCGATGAGAACGCTTAGGGAGAAGGAACAAGGAAAGATCGTGAACGAAGCGCCATCGCAATCATCGGAGGTGAAAACAGAGGAAACAATGGCATCGGAATCGGAATCGGAATCGGAATCTGAATCTGTTGGAGGTGAATGCCAAGTTCTGCAGAGTCCTGGTTCAGCTTGTTCACAAACTCATACTACACACACAAAATCCGATAGTTGA
Predicted protein sequences of Glyma09g41030
>Glyma09g41030.1   sequence type=predicted peptide   gene model=Glyma09g41030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQMQTQMLTPTTGVPKLRPRSGRTPLQLKNSPADPIQPSAKLKSKPYFEISLIDKENNPIAAVAVPPAVPPETSLAEELSAVKKKLERMRADKERTEKILNEKHALLDAWMKEMEERGENQKNFEIEVDRLFRLKELKYRCMRVSPMRTLREKEQGKIVNEAPSQSSEVKTEETMASESESESESESVGGECQVLQSPGSACSQTHTTHTKSDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo