Glyma09g40791 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g40791

Feature Type:	gene_model
Chromosome:	Gm09
Start:	45611516
stop:	45613454
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g40791

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G01960	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr5:370811-372775 FORWARD LENGTH=426	SoyBase	E_val: 5.00E-24	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR15860	Panther	UNCHARACTERIZED RING FINGER-CONTAINING PROTEIN	JGI		ISS
UniRef100_B9T6G2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9T6G2_RICCO	SoyBase	E_val: 3.00E-22	ISS
UniRef100_I1N3C3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Spermatophyta RepID=I1N3C3_SOYBN	SoyBase	E_val: 1.00E-22	ISS

Expression Patterns of Glyma09g40791

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g40791 not represented in the dataset	Glyma09g40791 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g40791

Paralog	Evidence	Comments
Glyma18g45010	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g40791 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g271400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g40791

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g40791

Limit To All Plant Sequences

>Glyma09g40791.1   sequence type=CDS   gene model=Glyma09g40791   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACTATGGGGCTTGTGCAACATCAGAACAGGTCAATGCAGCCGGTGATCTTTGTGCTATTTGTCAGGAGAAGATGCATACCCCAATATTACTATGCTGTAAACATATTTTCTGTGAAGACTGTGTATCAGAGTGTTATTCTGAAGTCATATATATAAATACTAGCCAGGAAGTTTTTTCTGCTTTGAAGCTTTACTTTTTCAAAGTAGCAACCACGATCTATATACATCAACACATGTAA

Predicted protein sequences of Glyma09g40791

Limit To All Plant Sequences

>Glyma09g40791.1   sequence type=predicted peptide   gene model=Glyma09g40791   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHYGACATSEQVNAAGDLCAICQEKMHTPILLCCKHIFCEDCVSECYSEVIYINTSQEVFSALKLYFFKVATTIYIHQHM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain