SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g40550

Feature Type:gene_model
Chromosome:Gm09
Start:45457282
stop:45463287
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g40550
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G12110AT Annotation by Michelle Graham. TAIR10: sterol-4alpha-methyl oxidase 1-1 | chr4:7254197-7256004 FORWARD LENGTH=298 SoyBaseE_val: 7.00E-140ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0046520GO-bp Annotation by Michelle Graham. GO Biological Process: sphingoid biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080064GO-bp Annotation by Michelle Graham. GO Molecular Function: 4,4-dimethyl-9beta,19-cyclopropylsterol-4alpha-methyl oxidase activity SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000254GO-mf Annotation by Michelle Graham. GO Molecular Function: C-4 methylsterol oxidase activity SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0873 KOG C-4 sterol methyl oxidase JGI ISS
PTHR11863Panther STEROL DESATURASE JGI ISS
PTHR11863:SF21Panther SUBFAMILY NOT NAMED JGI ISS
PF04116PFAM Fatty acid hydroxylase superfamily JGI ISS
UniRef100_G7JK82UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sterol-4-methyl-oxidase n=1 Tax=Medicago truncatula RepID=G7JK82_MEDTR SoyBaseE_val: 3.00E-142ISS
UniRef100_I1L6V0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6V0_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma09g40550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g40550
ParalogEvidenceComments
Glyma18g45280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g40550 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g269200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g40550
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g40550
>Glyma09g40550.1   sequence type=CDS   gene model=Glyma09g40550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCCCTTACCATACCCTTGAAGGAGCACAAGTTGCACTAGGCAGAGGACTAACCCTTGCTGAGACAATATGGTTCAAATACTCTGCCAACAAACCTGATTTTGTTCTTCATTGCCACAACACTCTATTCTTGTGCTTATTTTACTCTATAGCTCCAATTCCTTTCGTATTAATGGAGCTTAGTGGGTATGAGAAGCTAAACAAACACAAAATTCAGCCCTCGGTTAAGAGATCATTCAAGGAAATGTTCAAGTGCTACAAAGATGTCATGGAGACCTTTGTCATTGCAGTTAGCCCACTACAGATAATTTCTTATCCCACCATCAAGTGGATTGGGATCAGAACTGGTTTGTCATTGCCATCAGGCTGGGAGTTATTTTGGCAATTATTTATTTACTTTGTCATAGAAGATTTTTCGAATTATTGGATTCATAGGATGCTCCATTGCAAGTGGGCATTTGAGAAGATTCACAAGGTTCATCATGAATATGTAGCACCAATTGGGCTCTCAGCACCTTATGCCCATTGGGCCGAGATAATCATATTGGGTATCCCCTCGTTTCTAGGCCCAGCACTGGTTCCTGGGCATATAACAACCTATTGGCTATGGTTCATTTTGCGACAGCTAGAAGCCATCGAGACTCATAGCGGGTATGATTTTCCTTGGAGTCCCACAAAATATATACCATTTTATGGAGGGCCTGCATACCATGACTACCATCACTACGTTGGTGGAAAAAGTCAAAGCAACTTTGCCTCAGTATTTACCTATTGTGACTACATTTACGGGACCCATAAGGGGTATCAATATCGGAAGCAGATGCGCAAGAAAAATTCTACTGACACCTTCATTGCCCAAAATTACAAGATGGATGGATAG
Predicted protein sequences of Glyma09g40550
>Glyma09g40550.1   sequence type=predicted peptide   gene model=Glyma09g40550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLPYHTLEGAQVALGRGLTLAETIWFKYSANKPDFVLHCHNTLFLCLFYSIAPIPFVLMELSGYEKLNKHKIQPSVKRSFKEMFKCYKDVMETFVIAVSPLQIISYPTIKWIGIRTGLSLPSGWELFWQLFIYFVIEDFSNYWIHRMLHCKWAFEKIHKVHHEYVAPIGLSAPYAHWAEIIILGIPSFLGPALVPGHITTYWLWFILRQLEAIETHSGYDFPWSPTKYIPFYGGPAYHDYHHYVGGKSQSNFASVFTYCDYIYGTHKGYQYRKQMRKKNSTDTFIAQNYKMDG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo