SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g40030

Feature Type:gene_model
Chromosome:Gm09
Start:44997182
stop:45002793
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g40030
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G28360AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L22p/L17e family protein | chr4:14029294-14030926 REVERSE LENGTH=271 SoyBaseE_val: 1.00E-86ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR13501Panther CHLOROPLAST 50S RIBOSOMAL PROTEIN L22-RELATED JGI ISS
PF00237PFAM Ribosomal protein L22p/L17e JGI ISS
UniRef100_G7IDE8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L22 n=2 Tax=Medicago truncatula RepID=G7IDE8_MEDTR SoyBaseE_val: 5.00E-100ISS
UniRef100_I1L6Q3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6Q3_SOYBN SoyBaseE_val: 1.00E-149ISS

Expression Patterns of Glyma09g40030
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g40030
ParalogEvidenceComments
Glyma18g46170 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g40030 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g264400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g40030
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g40030
>Glyma09g40030.2   sequence type=CDS   gene model=Glyma09g40030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCAGTGGCAGAGACACGTTTTCCCCTTTCTTCGCCACATTCACAAGCGAGCAGGAATTTCAAGTTCTGCTAACTTGCTGGCAAATTCATCTGAGGAAACACCTGTTTTGTCACCTTTAGTCCCAGTTTCATTATTGGGTAGTTCAAAAGGTGAAGACCAGAAGCAGAAAGTTGTTACTAAGCAAGAAAAAGTTCAAGCGGTATTAAAGGCAATAAAACAGAGTCCAAAGAAGGTCAACTTGGTTGCTGCTCTGGTTCGTGGTATGCTTGTTAAAGATGCATTGATGCAGTTGGAATTGACAATAAAACGAGCAGCAAAAACTGTATATCAGGTTATTCATTCAGCCCGAGCAAATGCCTCTCACAATCATGGGTTAGATCCAGAACGACTCATTGTTGCGGAAGCATTTGTAGGAAAGGGGTTTTACAAAAAGAGACTTTGGCCCCATGCTAAAGGAAAATCGTCGCTTAGAGTAAGACCAGAATGCAGGCTAACAGTTGTAGTAAGAGAGATAACTGCTGAAGAAGAGGCAGAGATTGCTAGGCTGAGGGTCCACAACTTCAAGAAACGCACCAAGCGTCAGCAACGACTTGTGCCTCATCAGCTCATTGTGTCCAATCCTATTTGGGGCCGCAAAAACAAATCTAGTGTAGACAAATCAAGCCGGCAAACTAAAAAGGCATCAGAGAATTAA
Predicted protein sequences of Glyma09g40030
>Glyma09g40030.2   sequence type=predicted peptide   gene model=Glyma09g40030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQWQRHVFPFLRHIHKRAGISSSANLLANSSEETPVLSPLVPVSLLGSSKGEDQKQKVVTKQEKVQAVLKAIKQSPKKVNLVAALVRGMLVKDALMQLELTIKRAAKTVYQVIHSARANASHNHGLDPERLIVAEAFVGKGFYKKRLWPHAKGKSSLRVRPECRLTVVVREITAEEEAEIARLRVHNFKKRTKRQQRLVPHQLIVSNPIWGRKNKSSVDKSSRQTKKASEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo