Report for Sequence Feature Glyma09g39930
Feature Type: gene_model
Chromosome: Gm09
Start: 44914177
stop: 44915067
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g39930
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G52790 AT
Annotation by Michelle Graham. TAIR10: peptidoglycan-binding LysM domain-containing protein | chr3:19566004-19566333 REVERSE LENGTH=109
SoyBase E_val: 1.00E-31 ISS
GO:0016998 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule catabolic process
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF01476 PFAM
LysM domain
JGI ISS
UniRef100_B6TQ19 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: LysM domain containing protein n=1 Tax=Zea mays RepID=B6TQ19_MAIZE
SoyBase E_val: 3.00E-29 ISS
UniRef100_I1L6P2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6P2_SOYBN
SoyBase E_val: 5.00E-78 ISS
Expression Patterns of Glyma09g39930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma09g39930
Paralog Evidence Comments
Glyma18g46280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma09g39930 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g263500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g39930
Coding sequences of Glyma09g39930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g39930.1 sequence type=CDS gene model=Glyma09g39930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTTTCAATTCCAAAAGGGCACCGATCTCAAGTTCAAAAGCCATAGCTGATGCAGCCTCATGGTGCTGTGCATGTTTTCTTGTGTCCCTCTTATTGCTATGCATATTCAGAGACATCTCTGCCCTTCATGATGATCAAGGGAACTTGATGATGAGAAGCAGCCATGTCTTGTCCAAGCCATCATGTGATGAAATATATGTGGTTGGAGAAGGTGAGACACTTCATACAATCAGTGACAAGTGTGGTGATCCCTTTATTGTGGAAAAGAACCCTCATATCCATGACCCTGATGATGTCTTCCCAGGACTTGTTCTCAAGATTACACGCTCACAAACAACATAG
Predicted protein sequences of Glyma09g39930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g39930.1 sequence type=predicted peptide gene model=Glyma09g39930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAFNSKRAPISSSKAIADAASWCCACFLVSLLLLCIFRDISALHDDQGNLMMRSSHVLSKPSCDEIYVVGEGETLHTISDKCGDPFIVEKNPHIHDPDDVFPGLVLKITRSQTT*