Glyma09g39830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g39830

Feature Type:	gene_model
Chromosome:	Gm09
Start:	44829689
stop:	44831844
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g39830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G59810	AT	Annotation by Michelle Graham. TAIR10: Small nuclear ribonucleoprotein family protein \| chr3:22096841-22097666 FORWARD LENGTH=91	SoyBase	E_val: 1.00E-53	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005732	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1783	KOG	Small nuclear ribonucleoprotein F	JGI		ISS
PTHR11021	Panther	SMALL NUCLEAR RIBONUCLEOPROTEIN F (SNRNP-F)	JGI		ISS
PF01423	PFAM	LSM domain	JGI		ISS
UniRef100_G7JCP5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: U6 snRNA-associated Sm-like protein LSm6 n=1 Tax=Medicago truncatula RepID=G7JCP5_MEDTR	SoyBase	E_val: 4.00E-59	ISS
UniRef100_I1L6N0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6N0_SOYBN	SoyBase	E_val: 2.00E-59	ISS

Expression Patterns of Glyma09g39830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g39830

Paralog	Evidence	Comments
Glyma18g46370	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g39830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g262700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g39830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma09g39830

Limit To All Plant Sequences

>Glyma09g39830.2   sequence type=transcript   gene model=Glyma09g39830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGTTTCACTCCGTTTCGTGCACATTGGTTGATTTTGAAACCCTAAAGTTTGGCCCTTTACACGTTTCTTGTCTTCTTATTATTTCCCCCATCTTTGTTTCGAGAAGCATTTGACGAAGAGAAAAGACAGTGAATTGCGGTTTCAATTCAACCCACTTCATCTCAGGTGTTTGAAGTTGAGATAAAATGAGTGGAACAGAGAAAGCAGGATCAGGAACCACGAAAACCCCTGCCGATTTTCTCAAATCCATTCGTGGGAGGCCGGTTGTTGTCAAGCTCAATTCTGGTGTTGATTACAGAGGTATACTTGCTTGTCTAGATGGCTATATGAATATTGCAATGGAGCAGACAGAGGAATACGTCAATGGACAATTGAAGAACAAGTATGGTGACGCTTTCATCCGAGGGAATAATGGTACTGATGTTTGAAATACAATGTTCTTTTTT

Coding sequences of Glyma09g39830

Limit To All Plant Sequences

>Glyma09g39830.1   sequence type=CDS   gene model=Glyma09g39830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGGAACAGAGAAAGCAGGATCAGGAACCACGAAAACCCCTGCCGATTTTCTCAAATCCATTCGTGGGAGGCCGGTTGTTGTCAAGCTCAATTCTGGTGTTGATTACAGAGGTATACTTGCTTGTCTAGATGGCTATATGAATATTGCAATGGAGCAGACAGAGGAATACGTCAATGGACAATTGAAGAACAAGTATGGTGACGCTTTCATCCGAGGGAATAATGTTCTATACATTAGTACCTCAAAGAGGACTCTAGCAGAGGGGGCTTAG

>Glyma09g39830.2   sequence type=CDS   gene model=Glyma09g39830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGGAACAGAGAAAGCAGGATCAGGAACCACGAAAACCCCTGCCGATTTTCTCAAATCCATTCGTGGGAGGCCGGTTGTTGTCAAGCTCAATTCTGGTGTTGATTACAGAGGTATACTTGCTTGTCTAGATGGCTATATGAATATTGCAATGGAGCAGACAGAGGAATACGTCAATGGACAATTGAAGAACAAGTATGGTGACGCTTTCATCCGAGGGAATAATGGTACTGATGTTTGA

Predicted protein sequences of Glyma09g39830

Limit To All Plant Sequences

>Glyma09g39830.1   sequence type=predicted peptide   gene model=Glyma09g39830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGTEKAGSGTTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTEEYVNGQLKNKYGDAFIRGNNVLYISTSKRTLAEGA*

>Glyma09g39830.2   sequence type=predicted peptide   gene model=Glyma09g39830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGTEKAGSGTTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTEEYVNGQLKNKYGDAFIRGNNGTDV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain