SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g39820

Feature Type:gene_model
Chromosome:Gm09
Start:44824003
stop:44827657
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g39820
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G61220AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr3:22663025-22664316 FORWARD LENGTH=296 SoyBaseE_val: 3.00E-123ISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0008106GO-mf Annotation by Michelle Graham. GO Molecular Function: alcohol dehydrogenase (NADP+) activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0047501GO-mf Annotation by Michelle Graham. GO Molecular Function: (+)-neomenthol dehydrogenase activity SoyBaseN/AISS
GO:0047504GO-mf Annotation by Michelle Graham. GO Molecular Function: (-)-menthol dehydrogenase activity SoyBaseN/AISS
KOG1208 KOG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) JGI ISS
PTHR24322Panther FAMILY NOT NAMED JGI ISS
PTHR24322:SF19Panther SUBFAMILY NOT NAMED JGI ISS
PF00106PFAM short chain dehydrogenase JGI ISS
UniRef100_G7L3I2UniRef Annotation by Michelle Graham. Most informative UniRef hit: (+)-neomenthol dehydrogenase n=1 Tax=Medicago truncatula RepID=G7L3I2_MEDTR SoyBaseE_val: 1.00E-159ISS
UniRef100_UPI0002338A35UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338A35 related cluster n=1 Tax=unknown RepID=UPI0002338A35 SoyBaseE_val: 0ISS

Expression Patterns of Glyma09g39820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g39820
ParalogEvidenceComments
Glyma18g46380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g39820 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g262600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g39820
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g39820
>Glyma09g39820.1   sequence type=CDS   gene model=Glyma09g39820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGAAGAAGCAAAAAGGTATGCTGTTGTGACAGGAGCAAATAAAGGGATTGGTTTTGGGATGTGTAAGAAATTGGCTTCAAGTGGGATTGTGGTGGTGCTAACAGCTAGAGATGAGAAGAATGGCTTCAAAGCTGTTGAAAAATTGAAAGAGTTTGGTCTCTCGGACCTTCTGGTTTTTCATCAGCTTGATGTGGATGACCCTGCTAGTGTTTCTGCCTTAGCTGATTTCATCAAAACCGAATTCGGGAAACTTGATATCTTGGTAAATAATGCAGCTGTTACTGGAGGCAAATTATTAGATGCTGATGCTTTCCTTAGAAAGAGAAACGGCGAACAAATTGATTGGAATGAAGTAGGATATGAAACTTATGAGTTAGCTGAACAATGTGTGGAAACAAACTTCTATGGTGTGAAAAGGGTAACTGAAGCCCTACTTCCCCTTCTCCAGCTATCCACTTCTCCAAGAATTGTAAATATCTCCTCCAGAGCAGGGCTCTTCAAGAATATACCAAATGAGTGGGCTAGAACAATGTTGAGTGACATTGAAAATCTTACAAGAGAAAAAATAGATGGGGTACTTGAAGAGTTTCAGAAAGATTTCAAAGAGGGGTCATTGGAGATCAAAGGTTGGCCAGCTTTTGCTTCTGCTTATACAATGTCAAAAGCAGCTTTGAATGCATACACAAGGATTATGGCCAAGAAATACCCTCGTTTTCACATAAACTCTGTGTGCCCTGGCTTTGTCAAGACTGATATGAACAACAACACTGGACAATTAAGCATTGATGAAGGGGCTGAAACTCCTGTATTGTTGGCACTGTTGCCAAATGGTGGTCCTTCTGGCTGTTTCTTTCATCAGGGTGAAGTAATACCCTTTTGA
Predicted protein sequences of Glyma09g39820
>Glyma09g39820.1   sequence type=predicted peptide   gene model=Glyma09g39820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGEEAKRYAVVTGANKGIGFGMCKKLASSGIVVVLTARDEKNGFKAVEKLKEFGLSDLLVFHQLDVDDPASVSALADFIKTEFGKLDILVNNAAVTGGKLLDADAFLRKRNGEQIDWNEVGYETYELAEQCVETNFYGVKRVTEALLPLLQLSTSPRIVNISSRAGLFKNIPNEWARTMLSDIENLTREKIDGVLEEFQKDFKEGSLEIKGWPAFASAYTMSKAALNAYTRIMAKKYPRFHINSVCPGFVKTDMNNNTGQLSIDEGAETPVLLALLPNGGPSGCFFHQGEVIPF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo