Glyma09g39811 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g39811): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g39811): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g39811

Feature Type:	gene_model
Chromosome:	Gm09
Start:	44817396
stop:	44822633
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g39811

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G61220	AT	Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein \| chr3:22663025-22664316 FORWARD LENGTH=296	SoyBase	E_val: 2.00E-42	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009813	GO-bp	Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010224	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV-B	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008106	GO-mf	Annotation by Michelle Graham. GO Molecular Function: alcohol dehydrogenase (NADP+) activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0047501	GO-mf	Annotation by Michelle Graham. GO Molecular Function: (+)-neomenthol dehydrogenase activity	SoyBase	N/A	ISS
GO:0047504	GO-mf	Annotation by Michelle Graham. GO Molecular Function: (-)-menthol dehydrogenase activity	SoyBase	N/A	ISS
PTHR24322	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24322:SF19	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00106	PFAM	short chain dehydrogenase	JGI		ISS
UniRef100_C0LZ70	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Short chain dehydrogenase/reductase n=1 Tax=Nandina domestica RepID=C0LZ70_NANDO	SoyBase	E_val: 2.00E-42	ISS
UniRef100_I1N3M6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N3M6_SOYBN	SoyBase	E_val: 6.00E-61	ISS

Expression Patterns of Glyma09g39811

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g39811 not represented in the dataset	Glyma09g39811 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g39811 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g262500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g39811

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g39811

Limit To All Plant Sequences

>Glyma09g39811.1   sequence type=CDS   gene model=Glyma09g39811   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATAAAGAATGGCATCAGCAACAATAAGAATGCAGTAGTCACAGGAGCAAACAAAGGGATAGGATTTGGAATATGCAAGCAATTGGTTTCTAGTGGCATCACAGTGGTGCTAACAGCAAGGGATGAGAAAAGGGGACTTGAAGCTGTTGAAAAGCTGAAAGAGTTTGGTGTGTCTGATGATCAAGTGGTGTTTCATCAGCTTGATGTGACTGACCCTAAAAGCATTGAATCCCTTGCAAATTTCATCAAAACCCAGTTTGGAAAACTTGATATCTTGGTGAATAATGCAGGAATTCATGGAGCATATGTTGACCGTGATGCTTTAGCTGCTGCTGCTGTGTATGTATTCCAAGCCATATAG

Predicted protein sequences of Glyma09g39811

Limit To All Plant Sequences

>Glyma09g39811.1   sequence type=predicted peptide   gene model=Glyma09g39811   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IKNGISNNKNAVVTGANKGIGFGICKQLVSSGITVVLTARDEKRGLEAVEKLKEFGVSDDQVVFHQLDVTDPKSIESLANFIKTQFGKLDILVNNAGIHGAYVDRDALAAAAVYVFQAI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain