SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g39730

Feature Type:gene_model
Chromosome:Gm09
Start:44761104
stop:44765835
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g39730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G61260AT Annotation by Michelle Graham. TAIR10: Remorin family protein | chr3:22675403-22676701 REVERSE LENGTH=212 SoyBaseE_val: 2.00E-58ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
PF03763PFAM Remorin, C-terminal region JGI ISS
PF03766PFAM Remorin, N-terminal region JGI ISS
UniRef100_B9RDP4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Remorin, putative n=1 Tax=Ricinus communis RepID=B9RDP4_RICCO SoyBaseE_val: 1.00E-65ISS
UniRef100_I1L6M0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6M0_SOYBN SoyBaseE_val: 3.00E-123ISS

Expression Patterns of Glyma09g39730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g39730
ParalogEvidenceComments
Glyma18g46470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g39730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g261700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g39730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g39730
>Glyma09g39730.1   sequence type=CDS   gene model=Glyma09g39730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGAGCTGCAATCGAAGCCCGAAACTGCCCTAGCTCCGGCTCCGGTTGCGGCTGAGGTGCCATCTAACGACGCTGTTGCAAAGAAAGCTTCTGAAACAGAGGAATCCAAGGCTACTGTTGTTGCATCAGAGAAGACACCAGTTCCTGAAAACAAACAAAGCTCAAGAGGATCCATTGATAGAGATATCGCTCTGGCAGAAGTAGAGAAAGAGAAAAAGCTGTCCTATGTGAAGGCATGGGAAGAAAGTGAAAAGGCCAAAGCAGAGAACAGAGCTCAAAAACAACTCTCAGCTATTGCTGCTTGGGAAAACAGCAAGAAGGCAACTCTTGAAGCTGAGCTGAAAAAAATTGAGGAGCAACTGGAGAAAAAGAAAGCAGAACATGGTGAAAGAATGAAGAACAAGGTGGCCTTAGTTCACAAGGAAGCAGGGGAGAAGAGGGCAATGATCGAAGCCAATCGTTGTGAAGAGGTTCTCAAGACAGAGGAAGTGGCGGCAAAATACCGAGCAACAGGAACCACTCCAAAGAAGACCATAGGGTGCTTTTGA
Predicted protein sequences of Glyma09g39730
>Glyma09g39730.1   sequence type=predicted peptide   gene model=Glyma09g39730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPELQSKPETALAPAPVAAEVPSNDAVAKKASETEESKATVVASEKTPVPENKQSSRGSIDRDIALAEVEKEKKLSYVKAWEESEKAKAENRAQKQLSAIAAWENSKKATLEAELKKIEEQLEKKKAEHGERMKNKVALVHKEAGEKRAMIEANRCEEVLKTEEVAAKYRATGTTPKKTIGCF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo