Glyma09g39621 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g39621

Feature Type:	gene_model
Chromosome:	Gm09
Start:	44665105
stop:	44665791
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g39621

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF00228	PFAM	Bowman-Birk serine protease inhibitor family	JGI		ISS
UniRef100_A4PIB8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Trypsin inhibitor n=1 Tax=Apios americana RepID=A4PIB8_9FABA	SoyBase	E_val: 4.00E-33	ISS
UniRef100_UPI0002338A6F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338A6F related cluster n=1 Tax=unknown RepID=UPI0002338A6F	SoyBase	E_val: 2.00E-84	ISS

Expression Patterns of Glyma09g39621

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g39621 not represented in the dataset	Glyma09g39621 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g39621

Paralog	Evidence	Comments
Glyma18g46580	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g39621 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma09g39621

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g39621

Limit To All Plant Sequences

>Glyma09g39621.1   sequence type=CDS   gene model=Glyma09g39621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTTGAAGAAGGTGGGATTGGTGCTTTTCTTGTTAGGATTCACAGCAACTACTGTGGATGCTACTGGCTTCAACCCTAATTCCCTCATCACTCAGCTGCTCCCACAAATCGAGGGTGATTCTGATGATAACTATGTCAAATCCAACACCGAACCGTGCTGTGATAACTGTCTTTGCACAAACTCAATTCCTCCCAAATGCCAATGTACGGATTGGGCAGAAGACTGCCACTCAGCTTGCAAAGGGTGTATTTGTCAGAGGATATGGCCTCCTCGGTGTCGATGTTTCGATGAAACTGACACATGCTATGACAAATGTACCAGCACCTCCCAAGAAACTGCCAAAGCTCATGATCGCTACAACTAA

Predicted protein sequences of Glyma09g39621

Limit To All Plant Sequences

>Glyma09g39621.1   sequence type=predicted peptide   gene model=Glyma09g39621   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELKKVGLVLFLLGFTATTVDATGFNPNSLITQLLPQIEGDSDDNYVKSNTEPCCDNCLCTNSIPPKCQCTDWAEDCHSACKGCICQRIWPPRCRCFDETDTCYDKCTSTSQETAKAHDRYN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain