Glyma09g39578 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g39578

Feature Type:	gene_model
Chromosome:	Gm09
Start:	44633836
stop:	44634407
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g39578

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF05938	PFAM	Plant self-incompatibility protein S1	JGI		ISS
UniRef100_I1L6K1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6K1_SOYBN	SoyBase	E_val: 3.00E-55	ISS
UniRef100_Q9AXI6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Suspensor-specific protein n=1 Tax=Phaseolus coccineus RepID=Q9AXI6_PHACN	SoyBase	E_val: 5.00E-12	ISS

Expression Patterns of Glyma09g39578

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g39578 not represented in the dataset	Glyma09g39578 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g39578

Paralog	Evidence	Comments
Glyma18g46650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g39578 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g259700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g39578

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g39578

Limit To All Plant Sequences

>Glyma09g39578.1   sequence type=CDS   gene model=Glyma09g39578   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTTGTTTGCTAAAAGTGTTTCCATACTTTGGGTGTTTATGCTTTTATCATCAAACAATGCTATGGCGGTGAAGAATCTCGTTATTGAGGTCACAAATAATTTGGCAGGAAATTTGGACTTAAACGTTTCTTGTCCCAATATTGATTCTGCACATGAACAGCACCTTCTTCACCCGGGTACTCACCATCAATGGAGTTATTCTGGTTATATGCAACCTACAAAGCCACCGTTCCTTTGTTCCTTTCAATGGCAAGGACAAGGTGCCTCTCGTTCGTTTAATATGTACGTTCCAACTCTGGATTTTTATCGCGTACAGAGTCATTGGTATATAAAACAAAGTGGACCATGTAGGATGGATTCTTTATTCCTTCCCATGCCCACTTATGTTTGTTCTGAATGGGAGTAA

Predicted protein sequences of Glyma09g39578

Limit To All Plant Sequences

>Glyma09g39578.1   sequence type=predicted peptide   gene model=Glyma09g39578   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLFAKSVSILWVFMLLSSNNAMAVKNLVIEVTNNLAGNLDLNVSCPNIDSAHEQHLLHPGTHHQWSYSGYMQPTKPPFLCSFQWQGQGASRSFNMYVPTLDFYRVQSHWYIKQSGPCRMDSLFLPMPTYVCSEWE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain