SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g39130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g39130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g39130

Feature Type:gene_model
Chromosome:Gm09
Start:44284760
stop:44288191
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01310AT Annotation by Michelle Graham. TAIR10: Ribosomal L5P family protein | chr4:544166-545480 REVERSE LENGTH=262 SoyBaseE_val: 5.00E-133ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0398 KOG Mitochondrial/chloroplast ribosomal protein L5/L7 JGI ISS
PTHR11994Panther 60S RIBOSOMAL PROTEIN L11-RELATED JGI ISS
PTHR11994:SF4Panther 50S RIBOSOMAL PROTEIN L5 JGI ISS
PF00281PFAM Ribosomal protein L5 JGI ISS
PF00673PFAM ribosomal L5P family C-terminus JGI ISS
UniRef100_G7L6M1UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L5 n=1 Tax=Medicago truncatula RepID=G7L6M1_MEDTR SoyBaseE_val: 4.00E-145ISS
UniRef100_UPI0002338906UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338906 related cluster n=1 Tax=unknown RepID=UPI0002338906 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g39130 not represented in the dataset

Glyma09g39130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g47200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g255500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g39130.2   sequence type=CDS   gene model=Glyma09g39130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACCGCTCCTTCGCTTCTACACTCATCTGGGTCCTCTTTCTTCTCTCAATTTCGTGCCTTTCAATTCTCTTCTTCTTTGCTGTTCCCTCATAGTAACAAGCATGGGAATGCACTGGTCTCTGTGAAGGCCTCTGTTTCTGGGGTTGTGTTGGTGGAGAAGTCTGAGGCAGAGAAGGCCAATAGGCTCAAAACAGCTTACACTGAGAAAATTATTCCCTTGCTCATGGAAGAGTTCTCCTACACCAACAAACACCAGGTGCCTAAAATTGAGAAGATTGTGGTGAACTGTGGTATCGGAGATGCTGCACAAAATGCAAAGGGTTTGGACGCGGCAATAAGTGATCTAGCACTGATCACAGGGCAGAGACCTATTAAGACTCGGGCCAGGGCTTCTCTTGCCACCTTTAAGATCAGGGAAGGTCAACCACTTGGGATTTCTGTGACACTAAGAGGAAATATGATGTACTCATTCCTAGACCGAGTTGTCAACTTGGGACTTCCTAGGACAAGAGATTTCCAAGGTGTGAACCCCAACAGCTTTGATGGGCATGGGAACTACAGCATTGGCATTAAGGACCAGGGTGTCTTCCCAGAGATCAGAGCTGATGTTGTTGGTAAGCCTCGGGGAATGGATATCTGCATCGCAACAACAGCTAAAACCGACCAAGAAGCACACAAATTGTTGGCTCTTATGGGTATGCCCTTCAGAGAGGGAAGTGGTCCCGCCACCACAATTCGGAAAAAGAAGCTCAAGTCTCATCATTTTGATGCAAAATCAAAGGGAAGAGGAAGGAAGTGA

>Glyma09g39130.2   sequence type=predicted peptide   gene model=Glyma09g39130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATAPSLLHSSGSSFFSQFRAFQFSSSLLFPHSNKHGNALVSVKASVSGVVLVEKSEAEKANRLKTAYTEKIIPLLMEEFSYTNKHQVPKIEKIVVNCGIGDAAQNAKGLDAAISDLALITGQRPIKTRARASLATFKIREGQPLGISVTLRGNMMYSFLDRVVNLGLPRTRDFQGVNPNSFDGHGNYSIGIKDQGVFPEIRADVVGKPRGMDICIATTAKTDQEAHKLLALMGMPFREGSGPATTIRKKKLKSHHFDAKSKGRGRK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo