SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g39111

Feature Type:gene_model
Chromosome:Gm09
Start:44270155
stop:44274048
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g39111
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G52660AT Annotation by Michelle Graham. TAIR10: Homeodomain-like superfamily protein | chr5:21359423-21362037 REVERSE LENGTH=330 SoyBaseE_val: 1.00E-89ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
KOG0724 KOG Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains JGI ISS
PTHR12802Panther SWI/SNF COMPLEX-RELATED JGI ISS
PTHR12802:SF30Panther OS06G0105800 PROTEIN JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_Q0PJI6UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB133 n=1 Tax=Glycine max RepID=Q0PJI6_SOYBN SoyBaseE_val: 1.00E-120ISS
UniRef100_UPI00023388C8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023388C8 related cluster n=1 Tax=unknown RepID=UPI00023388C8 SoyBaseE_val: 0ISS

Expression Patterns of Glyma09g39111
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g39111 not represented in the dataset
Glyma09g39111 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g39111
ParalogEvidenceComments
Glyma18g47230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g39111 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g255300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g39111
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g39111
>Glyma09g39111.1   sequence type=CDS   gene model=Glyma09g39111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTCCCTCAACCCAAACCCACCTCAAACTTTTCACTTCTTCGACCCCTTCCACATGGAGGATCAGAGTAAGAAGGTTCGAAAACCTTACACCATTACCAAGTCCAGAGAGAATTGGACTGACCAAGAGCATGACAAGTTTCTTGAAGCTCTTCACTTATTCGAACGTGACTGGAAGAAGATTGAAGCATTTGTAGGTTCAAAAACAATAAGGAGTCATGCACAGAAATATTTCATGAAAATTCAGAAGAATGGCACAAGTGAACATGTACCTCCCCCTCGTCCAAAGAGAAAAGCTGCTCATCCATACCCACAAAAGGCTTCTAAAAATTCTCCTACTATATCCCAAGTTGCACGGCCATTCCAATCTTCATCTGCTTTATCTGAATCATCAAACATTTATAGGCCAGATTCATCATCTGTGCTTAGAACTCCAGTTAGCAGTGTACCATTACCATCTTGGGGTTATAATGTTGCACCACCGATCGGTCTTCCTAGTTACTGCTATAGCAGTAGTAATGAGAGCACTCCTAGGGGTTGGCCAAGTAGCAAAGAGAGTGATCAAGGAAAGTCAATTATAGTAATGCCAGATTTTGCACAAGTCTATAGATTCATTGGAAGTGTATTTGATCCAAATGCGACTAATCATCTACAGACACTGAAACAGATGAACCCAATAAATGTGAAAACTGTATTGCTATCGATGAGAAACCTCTCCACCAATTTGAGGAGTCCTGAATTTGAGAATGAGAGAAGGTTGCTGTCGTTGTACAATGCTAACTTGGAGAAGGGAAAATCTGGTAGTCATCATCGCAACCAACCCCTCAGTGACAGATCAGAGAGTGCCGTCTTATATGCTTAA
Predicted protein sequences of Glyma09g39111
>Glyma09g39111.1   sequence type=predicted peptide   gene model=Glyma09g39111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSLNPNPPQTFHFFDPFHMEDQSKKVRKPYTITKSRENWTDQEHDKFLEALHLFERDWKKIEAFVGSKTIRSHAQKYFMKIQKNGTSEHVPPPRPKRKAAHPYPQKASKNSPTISQVARPFQSSSALSESSNIYRPDSSSVLRTPVSSVPLPSWGYNVAPPIGLPSYCYSSSNESTPRGWPSSKESDQGKSIIVMPDFAQVYRFIGSVFDPNATNHLQTLKQMNPINVKTVLLSMRNLSTNLRSPEFENERRLLSLYNANLEKGKSGSHHRNQPLSDRSESAVLYA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo