SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g39000

Feature Type:gene_model
Chromosome:Gm09
Start:44180119
stop:44182004
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g39000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G41570AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 24 | chr5:16624220-16625689 FORWARD LENGTH=179 SoyBaseE_val: 2.00E-55ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_G7L6N9UniRef Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor n=1 Tax=Medicago truncatula RepID=G7L6N9_MEDTR SoyBaseE_val: 6.00E-87ISS
UniRef100_I1L6F2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6F2_SOYBN SoyBaseE_val: 4.00E-143ISS

Proteins Associated with Glyma09g39000
LocusGene SymbolProtein Name
WRKY123 WRKY Transcription Factor

Expression Patterns of Glyma09g39000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g39000
ParalogEvidenceComments
Glyma18g47350 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g39000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g254400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g39000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g39000
>Glyma09g39000.1   sequence type=CDS   gene model=Glyma09g39000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGCCAAGACCCACCAAACCCACCACCCCAAAACAACCCTTTCATATTCACTCCTAATTCGATGTTGCAAAACCCTAATTGGGACCCTCAAGAGCAATCAGGGCTATGTGACATTGATTGGGGTAACCTTTTCTCTGCCCAAAACGGCTTATTGCTTAATGGGGATGCTAAAGATGCAATTGAATGTGCTTCTTCTTTTTCTTTTGTGGCTCAAAATAAGGGAGTTTGTGAGGAGGAAAAGGGAAACAAGGAGAAAAGGAAAGGTGGGAGGATGAAGAAAACAACACGAGTACCAAGGTTTGCGTTTCAAACGAGAAGTGCAGATGATATTTTGGATGATGGTTATCGCTGGAGGAAATATGGTCAGAAAGCTGTGAAGAATAGCACATATCCAAGAAGCTACTACCGCTGCACGCATCACACGTGCAATGTGAAGAAACAAGTTCAAAGGCTATCCAAAGACACAAGCATTGTGGTGACGACTTACGAGGGAATTCACAACCACCCGTGCGAGAAGCTCATGGAAACTCTAACCCCTCTTCTCAAGCAAATACAGTTTCTTGCTAGCTTGTAA
Predicted protein sequences of Glyma09g39000
>Glyma09g39000.1   sequence type=predicted peptide   gene model=Glyma09g39000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESQDPPNPPPQNNPFIFTPNSMLQNPNWDPQEQSGLCDIDWGNLFSAQNGLLLNGDAKDAIECASSFSFVAQNKGVCEEEKGNKEKRKGGRMKKTTRVPRFAFQTRSADDILDDGYRWRKYGQKAVKNSTYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHPCEKLMETLTPLLKQIQFLASL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo