SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g38880

Feature Type:gene_model
Chromosome:Gm09
Start:44123147
stop:44124370
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g38880
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G61550AT Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr3:22776444-22777082 FORWARD LENGTH=212 SoyBaseE_val: 7.00E-75ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG2930 KOG SCF ubiquitin ligase, Rbx1 component JGI ISS
PTHR14155Panther RING FINGER PROTEIN 6/12/38 JGI ISS
PTHR14155:SF24Panther OS05G0526600 PROTEIN JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_G7KQJ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ring finger protein n=2 Tax=Medicago truncatula RepID=G7KQJ2_MEDTR SoyBaseE_val: 6.00E-74ISS
UniRef100_I1L6D9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6D9_SOYBN SoyBaseE_val: 2.00E-132ISS

Expression Patterns of Glyma09g38880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g38880
ParalogEvidenceComments
Glyma18g47435 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g38880 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g253500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g38880
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g38880
>Glyma09g38880.1   sequence type=CDS   gene model=Glyma09g38880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCTTCTTCCATTCCCTCCTCCCCTGATCACTTCCCCCACCTCGGCCTCGGCTACTCCATCGCCATAGCCCTAGCCTTCCTCTTCCTCCTCTCCACCCTCCTCCTCTCCTCCTACCTCTGCTGCCGCCACAACCGCCGTCGCCTCCGCCACACCACCGCCGCCGCCACCTCCGACGGGGGCATCGTCCTGCCACGTGTCATCTTCGTGGCGGAGGACGAGGACGAGGATGGCAGCGTGGCGGTGGGGTTCGACCAGAGCGTGATAAACTCGTATCCGAGGTTCCAGTTCAACAGGGACAACGCACGGAACAATAATATTATTAACACCACGTGCTCGATATGTTTGTGCGAGTACAAGGATTCGGAGATGCTGAGGATGATGCCGGAGTGTCGCCATTACTTCCACCTATGTTGTCTCGATTCGTGGCTGAAGCTCAATGGCTCTTGCCCCGTTTGCAGAAACTCGCCGCTTCCGACGCCGCTTTCTACGCCGCTGCAGGAGGTGGTGCCGCTCTCTCAGTATGCTGCTGATAGGAGAAGAAATAGGTGA
Predicted protein sequences of Glyma09g38880
>Glyma09g38880.1   sequence type=predicted peptide   gene model=Glyma09g38880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSSIPSSPDHFPHLGLGYSIAIALAFLFLLSTLLLSSYLCCRHNRRRLRHTTAAATSDGGIVLPRVIFVAEDEDEDGSVAVGFDQSVINSYPRFQFNRDNARNNNIINTTCSICLCEYKDSEMLRMMPECRHYFHLCCLDSWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYAADRRRNR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo