Report for Sequence Feature Glyma09g38791
Feature Type: gene_model
Chromosome: Gm09
Start: 44059929
stop: 44061330
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g38791
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G65080 AT
Annotation by Michelle Graham. TAIR10: Membrane insertion protein, OxaA/YidC with tetratricopeptide repeat domain | chr1:24176619-24180729 FORWARD LENGTH=525
SoyBase E_val: 3.00E-30 ISS
GO:0051205 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein insertion into membrane
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0016021 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane
SoyBase N/A ISS
UniRef100_G7KQL5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: ALBINO3-like protein n=2 Tax=Medicago truncatula RepID=G7KQL5_MEDTR
SoyBase E_val: 1.00E-71 ISS
UniRef100_I1L6C7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1L6C7_SOYBN
SoyBase E_val: 5.00E-101 ISS
Expression Patterns of Glyma09g38791
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma09g38791
Paralog Evidence Comments
Glyma18g47545 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma09g38791 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma09g38791
Coding sequences of Glyma09g38791
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g38791.1 sequence type=CDS gene model=Glyma09g38791 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGGTTGTAGTAATATTATACTCTAATATACTCTTGCAGGGTAGCCAGCTCTATTGGGTTACCAATAGTTCATTAACCCTCATTCAGCAAATAACTCTTAGACATCCTGCTGTCCTTGCAAAGTTGGGGTTACTGGACAATAGTCCAAAGGGAGCTTCTGAGGAAATTGGTGCTTCTAAAACAGCTCCTTCACCAGGGTTACAAGATAATATTCCAACAGCAGCTATCAAGGAAACTGTTTCGCCTGAAAAAAATCCTCTGGATTCACCTGAAAAGTGGCATAGAATACCTATAGAGGAGATGTCCCCAAAAGAACTGATTACTCTTGCAGTCCTATTTTTAAACAGTGATGATAAAGAAAGTGCAATTCCCTTACTAAAACTAGCCCTTGATAAGGACCCTGAATATGTACGAGCTTTAGTTTTGATGGGACGGGTTCTATTGCTGAAGCATGTAAATGATGAAGCTCATGAGTACTTCGAGCGTGCAATATCGAAACTTTCTCTTGCGGAAGAAGTTGATCTTCCCAGAGGGCTGGAATTGCCTGCGAACGGCAGGGGAAACACATTGTTCTCTGAGAAAACTTTTGTCTCACAGGGAAAGAGCCAGAAGATCCAACTAGCAAAGGCTATTATTTTGATGGGTTAG
Predicted protein sequences of Glyma09g38791
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g38791.1 sequence type=predicted peptide gene model=Glyma09g38791 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKVVVILYSNILLQGSQLYWVTNSSLTLIQQITLRHPAVLAKLGLLDNSPKGASEEIGASKTAPSPGLQDNIPTAAIKETVSPEKNPLDSPEKWHRIPIEEMSPKELITLAVLFLNSDDKESAIPLLKLALDKDPEYVRALVLMGRVLLLKHVNDEAHEYFERAISKLSLAEEVDLPRGLELPANGRGNTLFSEKTFVSQGKSQKIQLAKAIILMG*