SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g38760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g38760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g38760

Feature Type:gene_model
Chromosome:Gm09
Start:44044620
stop:44048145
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54900AT Annotation by Michelle Graham. TAIR10: CAX interacting protein 1 | chr3:20341850-20342371 REVERSE LENGTH=173 SoyBaseE_val: 4.00E-62ISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0048653GO-bp Annotation by Michelle Graham. GO Biological Process: anther development SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
GO:0015038GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione disulfide oxidoreductase activity SoyBaseN/AISS
GO:0015297GO-mf Annotation by Michelle Graham. GO Molecular Function: antiporter activity SoyBaseN/AISS
KOG1752 KOG Glutaredoxin and related proteins JGI ISS
PTHR10293Panther GLUTAREDOXIN JGI ISS
PF00462PFAM Glutaredoxin JGI ISS
UniRef100_C6SWD5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWD5_SOYBN SoyBaseE_val: 2.00E-127ISS
UniRef100_G7KQL7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutaredoxin-like protein n=1 Tax=Medicago truncatula RepID=G7KQL7_MEDTR SoyBaseE_val: 3.00E-73ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g38760 not represented in the dataset

Glyma09g38760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g47570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g252200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g38760.1   sequence type=CDS   gene model=Glyma09g38760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTGGTGTTACTGCGCTAAGCCTATGACTTTGCAGTTGCCGTTGCAACCAAGAGCATCATCATCATTCCATTCCCACGTTGGAGGAGTAACAGTAACATCCTCAACACTGTCTCTTCGACTCTCTTCTACTCTTGTTTTCACCCACAACCTCCACTTCCAACCCAAACTCAAACGCGCTTCCACAACCGTTCGATGCTCCTCGGCATTGACTCCTCAATTGAAGTCTACCTTGGATCAAGTTATTGCTTCAAATAAAGTAGTTGTGTTTATGAAGGGAACTAAAGATTTTCCACAGTGTGGATTCTCAAACACAGTGGTGCAAATATTGAAGTCTCTAAATGTGCCTTTTGAAACCATAAACGTGCTTGAAAATGACTTGTTGCGCCAAGGGCTGAAGGAGTACTCCAGTTGGCCTACCTTTCCTCAAGTCTACATAGAAGGAGAGTTTTTTGGTGGCTGTGATATCACTGTTGATGCATATCAGAAGGGGGAATTGCAGGAGCTGTTGGAGAAGGCAATGTTGTCCTGA

>Glyma09g38760.1   sequence type=predicted peptide   gene model=Glyma09g38760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSWCYCAKPMTLQLPLQPRASSSFHSHVGGVTVTSSTLSLRLSSTLVFTHNLHFQPKLKRASTTVRCSSALTPQLKSTLDQVIASNKVVVFMKGTKDFPQCGFSNTVVQILKSLNVPFETINVLENDLLRQGLKEYSSWPTFPQVYIEGEFFGGCDITVDAYQKGELQELLEKAMLS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo