SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g38610

Feature Type:gene_model
Chromosome:Gm09
Start:43942279
stop:43944590
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g38610
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G12800AT Annotation by Michelle Graham. TAIR10: photosystem I subunit l | chr4:7521469-7522493 FORWARD LENGTH=219 SoyBaseE_val: 2.00E-99ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009522GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem I SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009538GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem I reaction center SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02605PFAM Photosystem I reaction centre subunit XI JGI ISS
UniRef100_C6T3Q7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Papilionoideae RepID=C6T3Q7_SOYBN SoyBaseE_val: 2.00E-150ISS
UniRef100_Q2HW07UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem I reaction center subunit XI n=1 Tax=Medicago truncatula RepID=Q2HW07_MEDTR SoyBaseE_val: 5.00E-115ISS

Expression Patterns of Glyma09g38610
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g38610
ParalogEvidenceComments
Glyma18g47710 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g38610 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g250800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g38610
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g38610
>Glyma09g38610.1   sequence type=CDS   gene model=Glyma09g38610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTGCTTCCCCAATGGCAAGCCAACTCAAGTCCACCTTCACTAGGACTCTTGTAGCTCCCAAGGGCCTCTCTGCCTCTTCACCACTTCACCTCGTGCCTTCTAGAAGGCAATTTAGCTTCACTGTTAAGGCCATCCAATCAGAGAAGCCAACCTATCAAGTGATTCAGCCAATCAACGGTGACCCATTCATTGGAAGCCTGGAAACCCCAGTTACATCCAGCCCTTTGATCGCATGGTACTTGTCCAACCTGCCCGCATACAGAACCGCAGTGAGCCCACTACTAAGAGGGATCGAGGTGGGCCTGGCCCACGGATACCTTCTGGTGGGCCCATTCGTGAAGGCCGGGCCTCTTAGGAACACCGAGATCGCCGGGCAAGCGGGCTCTCTGGCCGCCGGTGGGCTTGTGGTGATCCTCAGCCTTTGCCTCACAATCTATGGGATTTCATCCTTCAACGAAGGAGCCCCATCCACTGCTCCGTCGCTGACCTTGACGGGCCGCAAGAAGGAGCCCGATCAGCTCCAAACTGCTGATGGGTGGGCCAAGTTCACCGGAGGCTTCTTCTTCGGAGGCATTTCGGGTGTTATTTGGGCCTACTTCCTCCTCTACGTCTTGGACCTTCCATACTACATCAAATGA
Predicted protein sequences of Glyma09g38610
>Glyma09g38610.1   sequence type=predicted peptide   gene model=Glyma09g38610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAASPMASQLKSTFTRTLVAPKGLSASSPLHLVPSRRQFSFTVKAIQSEKPTYQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSLCLTIYGISSFNEGAPSTAPSLTLTGRKKEPDQLQTADGWAKFTGGFFFGGISGVIWAYFLLYVLDLPYYIK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo