Glyma09g38600 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g38600

Feature Type:	gene_model
Chromosome:	Gm09
Start:	43930998
stop:	43934032
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g38600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02800	AT	Annotation by Michelle Graham. TAIR10: Tyrosine phosphatase family protein \| chr3:606638-607704 REVERSE LENGTH=203	SoyBase	E_val: 3.00E-99	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0016311	GO-bp	Annotation by Michelle Graham. GO Biological Process: dephosphorylation	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0043407	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of MAP kinase activity	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004721	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphoprotein phosphatase activity	SoyBase	N/A	ISS
GO:0004725	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tyrosine phosphatase activity	SoyBase	N/A	ISS
GO:0016791	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatase activity	SoyBase	N/A	ISS
KOG1572	KOG	Predicted protein tyrosine phosphatase	JGI		ISS
PTHR11584	Panther	SERINE/THREONINE PROTEIN KINASE	JGI		ISS
PTHR11584:SF266	Panther	SERINE/THREONINE-PROTEIN KINASE	JGI		ISS
PF03162	PFAM	Tyrosine phosphatase family	JGI		ISS
UniRef100_B9RM86	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Tyrosine-protein phosphatase SIW14, putative n=1 Tax=Ricinus communis RepID=B9RM86_RICCO	SoyBase	E_val: 2.00E-100	ISS
UniRef100_C6TK77	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TK77_SOYBN	SoyBase	E_val: 7.00E-148	ISS

Expression Patterns of Glyma09g38600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g38600

Paralog	Evidence	Comments
Glyma18g47720	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g38600 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g250700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g38600

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g38600

Limit To All Plant Sequences

>Glyma09g38600.1   sequence type=CDS   gene model=Glyma09g38600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAATGATAGTGGAGGTTGAAAACGAAAACGGAGACCTAAACGACGCCGTTCTTGTTCCACCCCCTAACTTCTCCATGGTCGAGGACTGCATTTTCCGATCCGGCCTCCCCAACCCTTCCAATTTCCCCTTTCTCCAAACCCTAAACCTTCGTTCCATCATATACCTGTGCCCTGAGCCTTATCCGGAAGAAAATCTGGACTTCCTTCGTTCGCAGAATATTCGCCTTTTTCAATTTGGAATTGAGGGGAAAACGGACATTTCTATGCCTATTCTCAAGGATTCTATCATGGATGCACTGGAAGTTTTAATTGATGTGAGAAATCACCCTGTTTTGATCCATTGCAAGCGAGGAAAGCATAGAACAGGTTGCCTTGTTGGTTGCTTGCGAAAATTACAGAACTGGTGTTTGTCCTCTGTGTTTGAGGAGTATCAACGATTTGCTGGTGCTAAATCCAGGACAATGGATTTAGCATTCATAGAAATGTTTGATGTTCTAAGCCTGAGTCAGTGCCTTTACAGCATCATCTACCAGTACCATGGTTCAAAGAAGCGTCGGTTGTTGTATAAAGATGAGAATTTACAGAAGCCCCGACTGACATCATTTTAG

Predicted protein sequences of Glyma09g38600

Limit To All Plant Sequences

>Glyma09g38600.1   sequence type=predicted peptide   gene model=Glyma09g38600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGMIVEVENENGDLNDAVLVPPPNFSMVEDCIFRSGLPNPSNFPFLQTLNLRSIIYLCPEPYPEENLDFLRSQNIRLFQFGIEGKTDISMPILKDSIMDALEVLIDVRNHPVLIHCKRGKHRTGCLVGCLRKLQNWCLSSVFEEYQRFAGAKSRTMDLAFIEMFDVLSLSQCLYSIIYQYHGSKKRRLLYKDENLQKPRLTSF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain