Report for Sequence Feature Glyma09g38590
Feature Type: gene_model
Chromosome: Gm09
Start: 43925053
stop: 43926141
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g38590
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G02790 AT
Annotation by Michelle Graham. TAIR10: zinc finger (C2H2 type) family protein | chr3:604926-605243 FORWARD LENGTH=105
SoyBase E_val: 2.00E-53 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
PTHR21213 Panther
FAMILY NOT NAMED
JGI ISS
UniRef100_B9RM85 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9RM85_RICCO
SoyBase E_val: 1.00E-56 ISS
UniRef100_I1L6A5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L6A5_SOYBN
SoyBase E_val: 5.00E-69 ISS
Expression Patterns of Glyma09g38590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma09g38590
Paralog Evidence Comments
Glyma18g47731 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma09g38590 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g250600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g38590
Coding sequences of Glyma09g38590
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g38590.1 sequence type=CDS gene model=Glyma09g38590 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACAGGGAAGGCGAAGCCGAAGAAGCACACGGCGAAGGAGATCGCGGCGAAGGTGGACGCGGCGACCACGAACCGCGGCGGCGGGAAGGCGGGTATGAAGGACCGAACCGGGTTGGAGAAGGGCGGGCACGCGAAATACGAGTGCCCTCACTGCAAGGTGACGGCGCCGGACGTGAAATCGATGCAGATCCACCACGACGCGCGTCACCCCAAGATCCCCTTCGAGGAGGACAAAGTTGTCAATCTTCACGCCACCACCAGCGTTCCCGAGTCCTCCAAGCCTCGCCCCGGTGTTCGCGGAAGCCTCAAGAAGTGA
Predicted protein sequences of Glyma09g38590
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g38590.1 sequence type=predicted peptide gene model=Glyma09g38590 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGMKDRTGLEKGGHAKYECPHCKVTAPDVKSMQIHHDARHPKIPFEEDKVVNLHATTSVPESSKPRPGVRGSLKK*