SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g38560

Feature Type:gene_model
Chromosome:Gm09
Start:43908594
stop:43909094
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g38560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16450AT Annotation by Michelle Graham. TAIR10: Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase | chr5:5374357-5375342 FORWARD LENGTH=166 SoyBaseE_val: 4.00E-104ISS
GO:0051252GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of RNA metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008428GO-mf Annotation by Michelle Graham. GO Molecular Function: ribonuclease inhibitor activity SoyBaseN/AISS
PF03737PFAM Demethylmenaquinone methyltransferase JGI ISS
UniRef100_B7FGQ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Regulator of ribonuclease-like protein n=1 Tax=Medicago truncatula RepID=B7FGQ6_MEDTR SoyBaseE_val: 3.00E-112ISS
UniRef100_UPI0001890A7EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001890A7E related cluster n=1 Tax=unknown RepID=UPI0001890A7E SoyBaseE_val: 1.00E-116ISS

Expression Patterns of Glyma09g38560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g38560
ParalogEvidenceComments
Glyma18g47760 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g38560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g250300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g38560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g38560
>Glyma09g38560.1   sequence type=CDS   gene model=Glyma09g38560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTTCGTCACCACTGCTGAAGTGTGTGATGCGAACCCCCAGTTAATTTTGAGTGGGGAGCTTCGTGCCCTTCAGCCAGTTTTTCAGATTTACGGTCGTCGACAGGTCTTCTCTGGACCTATAGTTACCTTGAAGGTGTTTGAAGACAATGTTTTGGTTCGTGAGTTCCTTGAAGAGAAAGGCAATGGAAGAGTGCTTGTTGTTGATGGAGGCGCGAGTTTACGCTGTGCTATATTGGGTGGCAACCCTGTGGTACAAGCTCAAAACAATGGATGGGCAGGTATTGTTGTGAATGGATGTATAAGAGATGTGGATGAGATCAATGGTTGTGATATTGGAGTGAGAGCCCTAGCTTCCCATCCCATGAAAGCCAATAAAAAAGGCATGGGAGAGAAGCATGTTCCTGTAAATATTGCTGGGACAAGGATCAGTGATGGGGATTGGCTCTATGCAGACACTGATGGAATTCTGATCTCTCGAACAGAGCTGTCTGTTTGA
Predicted protein sequences of Glyma09g38560
>Glyma09g38560.1   sequence type=predicted peptide   gene model=Glyma09g38560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFVTTAEVCDANPQLILSGELRALQPVFQIYGRRQVFSGPIVTLKVFEDNVLVREFLEEKGNGRVLVVDGGASLRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALASHPMKANKKGMGEKHVPVNIAGTRISDGDWLYADTDGILISRTELSV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo