Report for Sequence Feature Glyma09g38260
Feature Type: gene_model
Chromosome: Gm09
Start: 43654795
stop: 43658090
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g38260
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G44620 AT
Annotation by Michelle Graham. TAIR10: mitochondrial acyl carrier protein 1 | chr2:18414320-18415065 FORWARD LENGTH=122
SoyBase E_val: 8.00E-54 ISS
GO:0006633 GO-bp
Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process
SoyBase N/A ISS
GO:0010267 GO-bp
Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference
SoyBase N/A ISS
GO:0035196 GO-bp
Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA
SoyBase N/A ISS
GO:0051607 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to virus
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005759 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix
SoyBase N/A ISS
GO:0000036 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process
SoyBase N/A ISS
GO:0031177 GO-mf
Annotation by Michelle Graham. GO Molecular Function: phosphopantetheine binding
SoyBase N/A ISS
KOG1748
KOG
Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit
JGI ISS
PTHR20863 Panther
ACYL CARRIER PROTEIN/ZINC FINGER PROTEIN 593-RELATED
JGI ISS
PTHR20863:SF8 Panther
ACYL CARRIER PROTEIN
JGI ISS
PF00550 PFAM
Phosphopantetheine attachment site
JGI ISS
UniRef100_C6SZE2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZE2_SOYBN
SoyBase E_val: 3.00E-77 ISS
UniRef100_G7KSG3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Acyl carrier protein n=1 Tax=Medicago truncatula RepID=G7KSG3_MEDTR
SoyBase E_val: 2.00E-66 ISS
Expression Patterns of Glyma09g38260
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma09g38260
Paralog Evidence Comments
Glyma18g48110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma09g38260 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g247100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g38260
Coding sequences of Glyma09g38260
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g38260.1 sequence type=CDS gene model=Glyma09g38260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCACTGAGGGCAGCCGTGCTCCGCCACGTTCGTGTGCCACTCCAAGCCGCTCCAAAACTGCAGCCATGGCGTGCCATGTCATCACACGGCGACGATCATCTCTCCAAAGAGGAGGTCGTCGAAAGAGTCCTCGCCGTCGTCAAAGATTTCCCCAAAGTCGATCCTTCCAGGGTGAGTCCAGATGTACATTTCCAGAAGGATTTGGGTTTGGATAGCTTGGACAATGTGGAAATTGTAATGGCACTAGAAGAGGAGTTCAAGCTAGAGATCCCAGACAAGGAAGCTGATAAAATTGACTCTTGTCATCTTGCTATTGAGTACATTTCTAACCATCCCATGGCTGGTTAA
Predicted protein sequences of Glyma09g38260
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g38260.1 sequence type=predicted peptide gene model=Glyma09g38260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MALRAAVLRHVRVPLQAAPKLQPWRAMSSHGDDHLSKEEVVERVLAVVKDFPKVDPSRVSPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEADKIDSCHLAIEYISNHPMAG*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
