SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g38260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g38260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g38260

Feature Type:gene_model
Chromosome:Gm09
Start:43654795
stop:43658090
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44620AT Annotation by Michelle Graham. TAIR10: mitochondrial acyl carrier protein 1 | chr2:18414320-18415065 FORWARD LENGTH=122 SoyBaseE_val: 8.00E-54ISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005759GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix SoyBaseN/AISS
GO:0000036GO-mf Annotation by Michelle Graham. GO Molecular Function: ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process SoyBaseN/AISS
GO:0031177GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphopantetheine binding SoyBaseN/AISS
KOG1748 KOG Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit JGI ISS
PTHR20863Panther ACYL CARRIER PROTEIN/ZINC FINGER PROTEIN 593-RELATED JGI ISS
PTHR20863:SF8Panther ACYL CARRIER PROTEIN JGI ISS
PF00550PFAM Phosphopantetheine attachment site JGI ISS
UniRef100_C6SZE2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZE2_SOYBN SoyBaseE_val: 3.00E-77ISS
UniRef100_G7KSG3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acyl carrier protein n=1 Tax=Medicago truncatula RepID=G7KSG3_MEDTR SoyBaseE_val: 2.00E-66ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g38260 not represented in the dataset

Glyma09g38260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g48110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g247100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g38260.1   sequence type=CDS   gene model=Glyma09g38260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACTGAGGGCAGCCGTGCTCCGCCACGTTCGTGTGCCACTCCAAGCCGCTCCAAAACTGCAGCCATGGCGTGCCATGTCATCACACGGCGACGATCATCTCTCCAAAGAGGAGGTCGTCGAAAGAGTCCTCGCCGTCGTCAAAGATTTCCCCAAAGTCGATCCTTCCAGGGTGAGTCCAGATGTACATTTCCAGAAGGATTTGGGTTTGGATAGCTTGGACAATGTGGAAATTGTAATGGCACTAGAAGAGGAGTTCAAGCTAGAGATCCCAGACAAGGAAGCTGATAAAATTGACTCTTGTCATCTTGCTATTGAGTACATTTCTAACCATCCCATGGCTGGTTAA

>Glyma09g38260.1   sequence type=predicted peptide   gene model=Glyma09g38260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALRAAVLRHVRVPLQAAPKLQPWRAMSSHGDDHLSKEEVVERVLAVVKDFPKVDPSRVSPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEADKIDSCHLAIEYISNHPMAG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo