Glyma09g38210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g38210

Feature Type:	gene_model
Chromosome:	Gm09
Start:	43615828
stop:	43618673
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g38210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75670	AT	Annotation by Michelle Graham. TAIR10: DNA-directed RNA polymerases \| chr1:28415378-28416505 REVERSE LENGTH=196	SoyBase	E_val: 4.00E-73	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity	SoyBase	N/A	ISS
KOG4134	KOG	DNA-dependent RNA polymerase I	JGI		ISS
UniRef100_A2Q5X5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nucleic acid-binding, OB-fold n=1 Tax=Medicago truncatula RepID=A2Q5X5_MEDTR	SoyBase	E_val: 4.00E-98	ISS
UniRef100_UPI000233878F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233878F related cluster n=1 Tax=unknown RepID=UPI000233878F	SoyBase	E_val: 1.00E-167	ISS

Expression Patterns of Glyma09g38210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g38210

Paralog	Evidence	Comments
Glyma18g48180	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g38210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g246500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g38210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g38210

Limit To All Plant Sequences

>Glyma09g38210.2   sequence type=CDS   gene model=Glyma09g38210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGACTCAAGGTATCCAAAGCGAACTTAACTGCATACATTCACCCTTCCAAAACCAACCAAGTTTCCCAACCCATTCTCCGCCAACTCAGCTCCTTGCTTTTCAAGTTCAGCGAAATCTTCCACGGCGTCGTTTTGGCCTACGATCTCAACTCGCTCCACACGTGCGCCAAGATCCTCCCCGGCGTTCACCCTTACTTCGGCGTCAAACTCAAGGTCAATCTGTTGCTCTTTTCTCCCAAACCAAACATGCTCTTAGAAGGGAAGGTGGTTAAGGTTACGCAAGAGTCCATTCACGTTGTTGTGCTTGGCTTTTCCTCTGCGATTATAACTGAGAAAGATATCAGGGAAGAGTTCGTGTGCAAAACGAAACGAGGGCAAGAGGTTTATGCCAGCAGGTCTCACAAGCAGCATGTGATAAAGGTCGGGACCATGATACGGTTTTTAGTCAAGAGTTTTGATGAAGAAATACTTCATGTTTATGGATCTCTGGTTCCCGATCACACAGGCAGCATTTATTGGTTGGATAAGAACTTGGAAGCTGATTCCCATGTTTACAGGAGCAAAAAGAAGAGAAGAATTGTGCCAGAACGAATAATGCTAGAGCAAGATGCTGTGGATGGGGAACTGTCAACCTTGGACATTGTCCAAAAGAGCAAAAAATCAAAGAAGCAAAAGCACCAGGAGGAATCTTGA

Predicted protein sequences of Glyma09g38210

Limit To All Plant Sequences

>Glyma09g38210.2   sequence type=predicted peptide   gene model=Glyma09g38210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGLKVSKANLTAYIHPSKTNQVSQPILRQLSSLLFKFSEIFHGVVLAYDLNSLHTCAKILPGVHPYFGVKLKVNLLLFSPKPNMLLEGKVVKVTQESIHVVVLGFSSAIITEKDIREEFVCKTKRGQEVYASRSHKQHVIKVGTMIRFLVKSFDEEILHVYGSLVPDHTGSIYWLDKNLEADSHVYRSKKKRRIVPERIMLEQDAVDGELSTLDIVQKSKKSKKQKHQEES*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain