Glyma09g37950 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g37950

Feature Type:	gene_model
Chromosome:	Gm09
Start:	43474444
stop:	43477235
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g37950

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G26360	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein S21 family protein \| chr3:9655963-9656373 REVERSE LENGTH=101	SoyBase	E_val: 2.00E-33	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PF01165	PFAM	Ribosomal protein S21	JGI		ISS
UniRef100_C6T214	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T214_SOYBN	SoyBase	E_val: 2.00E-73	ISS
UniRef100_F4JCI2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S21 family protein n=2 Tax=Arabidopsis thaliana RepID=F4JCI2_ARATH	SoyBase	E_val: 7.00E-31	ISS

Expression Patterns of Glyma09g37950

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g37950

Paralog	Evidence	Comments
Glyma18g48440	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g37950 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g244200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g37950

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g37950

Limit To All Plant Sequences

>Glyma09g37950.1   sequence type=CDS   gene model=Glyma09g37950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACTCAGTTGCAAGGCGTTTATCAAGATTATTCAGACATTCAGGTTTCACGCCTGAACCCTTCAATAATGGCCATCATCAAATGCAGAAGCTTCAGCAATGCAGAGGCATAAGAGTGAAGGTCATAGGTGGGAACTTGGAAGCAGCATTGGGATTGATGCAGCGTAAGATGCAATCAAGTGGGATTGAGAGGATGATAAAGCAAGAGCAAAGATTCCATATCAAAAACTCTGAGAAGCGTGTTTTAGCCCAAAAGAACTTGGAGCGGAAGATTCGATCTGAAGATCTTGCTAGGAAACTTAAGGCCATTATGATCAAGAAAGTCAGGGGTCTATGA

Predicted protein sequences of Glyma09g37950

Limit To All Plant Sequences

>Glyma09g37950.1   sequence type=predicted peptide   gene model=Glyma09g37950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNSVARRLSRLFRHSGFTPEPFNNGHHQMQKLQQCRGIRVKVIGGNLEAALGLMQRKMQSSGIERMIKQEQRFHIKNSEKRVLAQKNLERKIRSEDLARKLKAIMIKKVRGL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain