SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma09g37950

Feature Type:gene_model
Chromosome:Gm09
Start:43474444
stop:43477235
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G26360AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S21 family protein | chr3:9655963-9656373 REVERSE LENGTH=101 SoyBaseE_val: 2.00E-33ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PF01165PFAM Ribosomal protein S21 JGI ISS
UniRef100_C6T214UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T214_SOYBN SoyBaseE_val: 2.00E-73ISS
UniRef100_F4JCI2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S21 family protein n=2 Tax=Arabidopsis thaliana RepID=F4JCI2_ARATH SoyBaseE_val: 7.00E-31ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g48440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g244200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g37950.1   sequence type=CDS   gene model=Glyma09g37950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACTCAGTTGCAAGGCGTTTATCAAGATTATTCAGACATTCAGGTTTCACGCCTGAACCCTTCAATAATGGCCATCATCAAATGCAGAAGCTTCAGCAATGCAGAGGCATAAGAGTGAAGGTCATAGGTGGGAACTTGGAAGCAGCATTGGGATTGATGCAGCGTAAGATGCAATCAAGTGGGATTGAGAGGATGATAAAGCAAGAGCAAAGATTCCATATCAAAAACTCTGAGAAGCGTGTTTTAGCCCAAAAGAACTTGGAGCGGAAGATTCGATCTGAAGATCTTGCTAGGAAACTTAAGGCCATTATGATCAAGAAAGTCAGGGGTCTATGA

>Glyma09g37950.1   sequence type=predicted peptide   gene model=Glyma09g37950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNSVARRLSRLFRHSGFTPEPFNNGHHQMQKLQQCRGIRVKVIGGNLEAALGLMQRKMQSSGIERMIKQEQRFHIKNSEKRVLAQKNLERKIRSEDLARKLKAIMIKKVRGL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo