Report for Sequence Feature Glyma09g37940
Feature Type: gene_model
Chromosome: Gm09
Start: 43473054
stop: 43474055
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g37940
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G18870 AT
Annotation by Michelle Graham. TAIR10: Mitochondrial transcription termination factor family protein | chr3:6508515-6509339 REVERSE LENGTH=274
SoyBase E_val: 4.00E-46 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0016556 GO-bp
Annotation by Michelle Graham. GO Biological Process: mRNA modification
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR13068 Panther
CGI-12 PROTEIN-RELATED
JGI ISS
PF02536 PFAM
mTERF
JGI ISS
UniRef100_I1L638 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L638_SOYBN
SoyBase E_val: 2.00E-74 ISS
UniRef100_Q2L8W8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: MTERF-like protein n=1 Tax=Brassica napus RepID=Q2L8W8_BRANA
SoyBase E_val: 6.00E-20 ISS
Expression Patterns of Glyma09g37940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma09g37940
Paralog Evidence Comments
Glyma18g48450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma09g37940 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g244100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g37940
Coding sequences of Glyma09g37940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g37940.2 sequence type=CDS gene model=Glyma09g37940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTGAACACGCGCGTGGACAAGCTGCATACGAAAGTTCTGTTCATGCAAGAGTTGGGGTTTTTGTACGAGAAAGCACTCAGAGCTTGTGCTAGGTTACCCGCAATTTTCGGATATGACGTGGAGAACAATCTGTGGCCCAAGTTTGTGTATCTTGTGAAGGAAATGGAGAGAGATTTGGAGGAGCTGAATAGGTTTCCTCAATACTTTGGGTTCAGTTTGAAGGAGAGGATTGTGCCAAGGCACTTGCATTTGAAGGAGAGGGGTGTTAGGATTCCCTTAAACAGAATGTTGATGTGGGGTAATGAAAAGTTCTACGCCAAGTGGAAGTAA
Predicted protein sequences of Glyma09g37940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g37940.2 sequence type=predicted peptide gene model=Glyma09g37940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLNTRVDKLHTKVLFMQELGFLYEKALRACARLPAIFGYDVENNLWPKFVYLVKEMERDLEELNRFPQYFGFSLKERIVPRHLHLKERGVRIPLNRMLMWGNEKFYAKWK*