SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g37860

Feature Type:gene_model
Chromosome:Gm09
Start:43388628
stop:43392382
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g37860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G02130AT Annotation by Michelle Graham. TAIR10: RAS 5 | chr1:400350-401788 REVERSE LENGTH=203 SoyBaseE_val: 2.00E-141ISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0000139GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi membrane SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0032588GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0084 KOG GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF227Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_Q39845UniRef Annotation by Michelle Graham. Most informative UniRef hit: Small GTP-binding protein n=1 Tax=Glycine max RepID=Q39845_SOYBN SoyBaseE_val: 1.00E-148ISS
UniRef100_Q39845UniRef Annotation by Michelle Graham. Best UniRef hit: Small GTP-binding protein n=1 Tax=Glycine max RepID=Q39845_SOYBN SoyBaseE_val: 1.00E-148ISS

Expression Patterns of Glyma09g37860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g37860
ParalogEvidenceComments
Glyma18g48610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g37860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g243300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g37860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g37860
>Glyma09g37860.1   sequence type=CDS   gene model=Glyma09g37860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCCCGAGTATGATTATCTGTTCAAGCTCCTTCTTATTGGAGACTCTGGTGTTGGTAAATCATGCCTTCTTCTGAGATTTTCTGATGATTCGTACATCGAAAGCTACATAAGCACCATTGGAGTTGATTTTAAAATACGTACCGTTGAGCAAGATGGAAAGACCATTAAACTACAGATCTGGGACACAGCTGGGCAAGAACGATTTAGGACAATCACCAGTAGCTACTACCGTGGTGCCCATGGGATCATTATTGTTTATGATGTGACAGATGAAGAGAGCTTCAATAATGTGAAGCAGTGGCTCAGTGAAATTGATCGCTATGCAAGTGATAATGTTAACAAGCTTTTGGTTGGCAACAAGTGTGATCTGGAAGCAAATAGAGCAGTGTCATATGAAACAGCTAAGGCATTTGCAGATGGAATAGGCATACCTTTTATGGAAACAAGTGCAAAAGATGCTACAAATGTCGAACAGGCTTTCATGGCAATGACTGCTTCAATCAAGGATAGAATGGCAAGCCAACCTGCAAATAATGCAAGGCCTCCAACAGTGCAGATCAGGGGTCAGCCAGTTGCACAGAAAGGTGGGTGCTGCTCTTCCTGA
Predicted protein sequences of Glyma09g37860
>Glyma09g37860.1   sequence type=predicted peptide   gene model=Glyma09g37860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPEYDYLFKLLLIGDSGVGKSCLLLRFSDDSYIESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKCDLEANRAVSYETAKAFADGIGIPFMETSAKDATNVEQAFMAMTASIKDRMASQPANNARPPTVQIRGQPVAQKGGCCSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo