Glyma09g37630 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g37630

Feature Type:	gene_model
Chromosome:	Gm09
Start:	43157112
stop:	43161499
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g37630

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G39990	AT	Annotation by Michelle Graham. TAIR10: Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein \| chr5:16004494-16006428 FORWARD LENGTH=447	SoyBase	E_val: 2.00E-145	ISS
GO:0006857	GO-bp	Annotation by Michelle Graham. GO Biological Process: oligopeptide transport	SoyBase	N/A	ISS
GO:0016051	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008375	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acetylglucosaminyltransferase activity	SoyBase	N/A	ISS
PTHR19297	Panther	GLYCOSYLTRANSFERASE 14 FAMILY MEMBER	JGI		ISS
PTHR19297:SF2	Panther	GALACTOSYLTRANSFERASE-RELATED	JGI		ISS
PF02485	PFAM	Core-2/I-Branching enzyme	JGI		ISS
UniRef100_B9RUK1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Acetylglucosaminyltransferase, putative n=1 Tax=Ricinus communis RepID=B9RUK1_RICCO	SoyBase	E_val: 2.00E-146	ISS
UniRef100_I1N499	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N499_SOYBN	SoyBase	E_val: 9.00E-170	ISS

Expression Patterns of Glyma09g37630

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g37630

Paralog	Evidence	Comments
Glyma18g48990	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g37630 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g241300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g37630

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g37630

Limit To All Plant Sequences

>Glyma09g37630.3   sequence type=CDS   gene model=Glyma09g37630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAACTAAAACACTACTATTCACACCACCACCACAACTCCTCCGAACAACAACAAAGAAAGTATCTGCTGCACGCGTTCTCGCATTTGCCACGCGATCTTAACTTCATTGATCATACCAGTGACATTGGCTGGAAAGATCATCAACGGGCGAGGCCTATAATTATTGATCCGGGGTTGTATATGACTAAGAAGCAAGACGTGTTCTGGATTACGCAGAGGAGAAGTAGGCCAACGGCTTTCAAACTTTTCACAGGTTCGGCTTGGATGGTACTATCAAGATCTTTCATTGATTACTGTATATGGGGGTGGGACAACCTACCTCGGACTGTTCTCATGTACTACACAAATTTCATATCTTCCCCTGAAGGGTACTTCCACACTGTCGTTTGTAATGCTCAAGAGTTCAAGAACACAACCGTTAACAGTGATCTTCACTTCATTTCTTGGGACAATCCTCCCAGGCAACACCCCCACTACCTTTCTCTTGATGACATGAAAAGGATGGTTGACAGCAATGCCCCCTTTGCGAGGAAGTTCCACGGAGATGATCCGGTATTGGACAAAATCGACACAGAGCTATTATCTCGAGGTCCTGGGATGGTTGTTCCTGGTGGCTGGTGCATAGGAAGCAGGGAGAATGGGAGTGATCCTTGTTCTGTAGTTGGTAATACTACTGTCCTCAGGCCTGGCCCTGGTTCAGAGAGGCTAGAAACCCTGATCAATTCGTTGTTGTCTGATGAAAATTTTCGACCAAAACAGTGTGTATGA

Predicted protein sequences of Glyma09g37630

Limit To All Plant Sequences

>Glyma09g37630.3   sequence type=predicted peptide   gene model=Glyma09g37630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKLKHYYSHHHHNSSEQQQRKYLLHAFSHLPRDLNFIDHTSDIGWKDHQRARPIIIDPGLYMTKKQDVFWITQRRSRPTAFKLFTGSAWMVLSRSFIDYCIWGWDNLPRTVLMYYTNFISSPEGYFHTVVCNAQEFKNTTVNSDLHFISWDNPPRQHPHYLSLDDMKRMVDSNAPFARKFHGDDPVLDKIDTELLSRGPGMVVPGGWCIGSRENGSDPCSVVGNTTVLRPGPGSERLETLINSLLSDENFRPKQCV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain