SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g37620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g37620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g37620

Feature Type:gene_model
Chromosome:Gm09
Start:43153554
stop:43155013
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g37620
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G28630AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF569) | chr3:10729065-10730564 FORWARD LENGTH=335 SoyBaseE_val: 4.00E-57ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04601PFAM Protein of unknown function (DUF569) JGI ISS
UniRef100_Q9LQ43UniRef Annotation by Michelle Graham. Most informative UniRef hit: T30E16.31 n=1 Tax=Arabidopsis thaliana RepID=Q9LQ43_ARATH SoyBaseE_val: 7.00E-52ISS
UniRef100_UPI00023385E7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023385E7 related cluster n=1 Tax=unknown RepID=UPI00023385E7 SoyBaseE_val: 2.00E-156ISS

Expression Patterns of Glyma09g37620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g37620 not represented in the dataset
Glyma09g37620 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g37620 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g241200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g37620
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g37620
>Glyma09g37620.1   sequence type=CDS   gene model=Glyma09g37620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATTCTTCCAAAAGGCCAAAGTGGTACGCTTAAGGAGCCACCGTGACAAATACTTGTTGGCAGATGATGACAAAGAAAGTGTTTTCCAAGATCAAGGTACACAAATAAGGCTTAAGACATGCCATGGCCAATATTTGCGTGCCAATGGAGGCTTACCACCTTGGAGGAACTCTATCACCCATGACATCCCACATAGAACATCAACATCAAATTGGGTTCTATGGGAGGTGGACCTTGTAGAGCTTCGACCAAACCCTCCCAACCCAATAGAAAACACTACACCTATTGCCACACCCAATCCTTCAATGGATTCTACCGAATTGGATTCTCCTACATATTCAGATGATGTCTCCTTTAATATAGATCTCAAGTCTTCTAAAGTACCAATTGAGAATGAGGATTTAAAGGAGAATGAGTCACCCAAAAAAGATGGAAGGGTTATATTTTATAATATAGGTGATGAAAATGGAGATGTTCCTAGTGCAAATGAAGAAAAGTTCTTTACATTCAAAGGAAGTAGCGTGGAAGATTTGAAGGAAAAGTTAAAAGAAGAAACAGGGCATGATGATATTCTTGTGTGTTGTCGCAACCCATTGAATGCAAAACTTTATCCCCTTCGTTTACAATTACCTCCTAACAATACTGACATACACGTTGTGGTTACTCCTTCTTAA
Predicted protein sequences of Glyma09g37620
>Glyma09g37620.1   sequence type=predicted peptide   gene model=Glyma09g37620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFFQKAKVVRLRSHRDKYLLADDDKESVFQDQGTQIRLKTCHGQYLRANGGLPPWRNSITHDIPHRTSTSNWVLWEVDLVELRPNPPNPIENTTPIATPNPSMDSTELDSPTYSDDVSFNIDLKSSKVPIENEDLKENESPKKDGRVIFYNIGDENGDVPSANEEKFFTFKGSSVEDLKEKLKEETGHDDILVCCRNPLNAKLYPLRLQLPPNNTDIHVVVTPS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo