Report for Sequence Feature Glyma09g37570
Feature Type: gene_model
Chromosome: Gm09
Start: 43096704
stop: 43101262
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g37570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G01280 AT
Annotation by Michelle Graham. TAIR10: voltage dependent anion channel 1 | chr3:85754-87612 FORWARD LENGTH=276
SoyBase E_val: 7.00E-150 ISS
GO:0006511 GO-bp
Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process
SoyBase N/A ISS
GO:0006820 GO-bp
Annotation by Michelle Graham. GO Biological Process: anion transport
SoyBase N/A ISS
GO:0009617 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to bacterium
SoyBase N/A ISS
GO:0009853 GO-bp
Annotation by Michelle Graham. GO Biological Process: photorespiration
SoyBase N/A ISS
GO:0044070 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of anion transport
SoyBase N/A ISS
GO:0051788 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to misfolded protein
SoyBase N/A ISS
GO:0055085 GO-bp
Annotation by Michelle Graham. GO Biological Process: transmembrane transport
SoyBase N/A ISS
GO:0080129 GO-bp
Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005741 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane
SoyBase N/A ISS
GO:0005773 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuole
SoyBase N/A ISS
GO:0005774 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009536 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plastid
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0008308 GO-mf
Annotation by Michelle Graham. GO Molecular Function: voltage-gated anion channel activity
SoyBase N/A ISS
KOG3126
KOG
Porin/voltage-dependent anion-selective channel protein
JGI ISS
PTHR11743 Panther
VOLTAGE-DEPENDENT ANION-SELECTIVE CHANNEL
JGI ISS
PTHR11743:SF14 Panther
VOLTAGE-DEPENDENT ANION-SELECTIVE CHANNEL-RELATED
JGI ISS
PF01459 PFAM
Eukaryotic porin
JGI ISS
UniRef100_B0M197 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal voltage-dependent anion-selective channel protein n=1 Tax=Glycine max RepID=B0M197_SOYBN
SoyBase E_val: 0 ISS
UniRef100_I1L602 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L602_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma09g37570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma09g37570
Paralog Evidence Comments
Glyma18g49070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma09g37570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g240600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g37570
Coding sequences of Glyma09g37570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g37570.1 sequence type=CDS gene model=Glyma09g37570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTAAGGGTCCCGGTCTCTACTCTGACATCGGCAAGAAAGCCAGGGATCTGCTGTTCAAGGACTACCACAGTGACCAGAAGTTCACCATCACCACCTACTCACCCACTGGAGTTGCTATAACAGCATCAGGAACCAGGAAAAGTGAACTGTTTGTGGCTGATGTCAACACCCAGTTGAAGAACAAAAACATCACTACTGATATCAAAGTTGATACAGATTCTAATCTCTTCACAACTATCACTGTTAATGAACCTGCTCCTGGTCTGAAGGCTATTTTTAGCTTCAAAGTTCCTGACCAAAGGTCTGGAAAGGTGGAAGTTCAGTACTTGCATGACTATGCTGGAATAAGCACCAGTGTTGGGTTGACAGCAAACCCAATTGTCAACTTCTCTGGTGTTATAGGAACTAATGTTCTTGCTCTTGGTGCTGATCTTTCTTTTGACACCAAAATTGGGGAGTTAACAAAATCCAATGCTGGACTGAGCTTCACCAAAGATGACTTGATTGCCTCATTGACTCTGAATGACAAAGGTGATGCTTTGAATGCTGCATATTACCATGTAGTTAACCCCTTGACCAACACTGCTGTTGGTGCTGAAGTGACCCATAGATTCTCAACTAATGAGAACACTCTCACTCTTGGTACCCAACATCAATTGGATCCATTGACCACATTGAAGGCACGTGTGAACAACTTTGGCAGGACAAGTGCTCTGATCCAGCATGAGTGGCGTCCCAAATCGTTCTTTACCATATCTGGTGAGGTAGACACCAAGGCCATTGAAAAGAGTGCTAAGGTTGGATTGGGTTTGGTTCTCAAACCCTAA
Predicted protein sequences of Glyma09g37570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g37570.1 sequence type=predicted peptide gene model=Glyma09g37570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQLKNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFDTKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTNENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVGLGLVLKP*