SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g37561): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g37561): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g37561

Feature Type:gene_model
Chromosome:Gm09
Start:43090031
stop:43093201
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15100AT Annotation by Michelle Graham. TAIR10: Auxin efflux carrier family protein | chr5:4892159-4893937 REVERSE LENGTH=367 SoyBaseE_val: 3.00E-137ISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010252GO-bp Annotation by Michelle Graham. GO Biological Process: auxin homeostasis SoyBaseN/AISS
GO:0010315GO-bp Annotation by Michelle Graham. GO Biological Process: auxin efflux SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0009672GO-mf Annotation by Michelle Graham. GO Molecular Function: auxin:hydrogen symporter activity SoyBaseN/AISS
PF03547PFAM Membrane transport protein JGI ISS
UniRef100_Q5FV66UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin efflux carrier protein n=1 Tax=Medicago truncatula RepID=Q5FV66_MEDTR SoyBaseE_val: 0ISS
UniRef100_UPI0002338611UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338611 related cluster n=1 Tax=unknown RepID=UPI0002338611 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g37561 not represented in the dataset

Glyma09g37561 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g49080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g240500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g37561.1   sequence type=CDS   gene model=Glyma09g37561   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTTCCTTAGCCGATGCCTATCATGTAGTGGCGTCCACCGTCCCATTATATGTGACCATGATACTGGCCTACATTTCTGTGAAATGGTGGAAAATCTTCACACCAGATCAATGTTCAGGCATAAACAAATTTGTGGCAAAGTTCTCTATCCCACTTTTGTCTTTTCAAGTCATTTCCTCTAACAACATCTACAAAATGAGCCTCAAACTCATATATGCCGACTTTCTTCAGAAATTGCTTGCATTTCTCGTCTTGATAGCAATCACTAAGATCAGTGGCCGAGGAGGCTTGAAATGGATCATAACTGGTTTGTCCATAACAACACTTCCTAACACTTTGATTCTTGGAATCCCTCTCGTGAAGGCTATGTATAAGAGTGAAGCAGTTGTTCTCCTGGCACAGATTATTTTCTTGCAGAGCATGATTTGGTACAATTTGTTGTTGTTCCTTTATGAACTTGATGCTGTCAAGACCAGGCCTACTGCAGCTGCATCATCATCACAAGGATCAGGTCGTGAAGTACAATCAAAAGGAGAAGAAGACGCAGAACCTAGAATAAAAAGGAAGAGGAAGGTCTTGCTCATTCTTGTCACAGTGGGAAAGAAGCTAATTAAAAATCCTAATACATATGCAACTTTATTGGGTTTTATTTGGTCAAGCATAAAATTTAGGTGGGGATTACATATGCCTGAAGTTGTTAGTCAGTCAATCGAAATATTGTCCAATGGAGGTCTAGGCATGGCCATGTTCAGCTTAGGTCTGTTTATGGCATCACAGTCAAGCATCATAGCATGTGGGCCAAGGATGGCAATGGTGGCAATAGGACTGAAAGTTGTGCTTGGACCTACCCTGATGGCTGTGGCTTCCTTTGTGATTGGATTAAGAGACACATTGTTTAAAGTGGCAATTGTTCAGGCAGCTCTACCCCAAGGAATTGTTCCTTTTGTTTTTGCCAAAGAGTATAATGTCCATCCAGCCGTTTTAAGCACTGCGATCTTGTTAGGAATGCTCATTGCCTTGCCGGTGGAATTGGCCTTCTACTTCCTATTAGCAATTTGA

>Glyma09g37561.1   sequence type=predicted peptide   gene model=Glyma09g37561   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MISLADAYHVVASTVPLYVTMILAYISVKWWKIFTPDQCSGINKFVAKFSIPLLSFQVISSNNIYKMSLKLIYADFLQKLLAFLVLIAITKISGRGGLKWIITGLSITTLPNTLILGIPLVKAMYKSEAVVLLAQIIFLQSMIWYNLLLFLYELDAVKTRPTAAASSSQGSGREVQSKGEEDAEPRIKRKRKVLLILVTVGKKLIKNPNTYATLLGFIWSSIKFRWGLHMPEVVSQSIEILSNGGLGMAMFSLGLFMASQSSIIACGPRMAMVAIGLKVVLGPTLMAVASFVIGLRDTLFKVAIVQAALPQGIVPFVFAKEYNVHPAVLSTAILLGMLIALPVELAFYFLLAI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo