SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g37331

Feature Type:gene_model
Chromosome:Gm09
Start:42901760
stop:42902166
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g37331
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G28917AT Annotation by Michelle Graham. TAIR10: mini zinc finger 2 | chr3:10925014-10925316 FORWARD LENGTH=100 SoyBaseE_val: 3.00E-20ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PF04770PFAM ZF-HD protein dimerisation region JGI ISS
UniRef100_B9T6Z4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9T6Z4_RICCO SoyBaseE_val: 6.00E-18ISS
UniRef100_I1L5Y1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L5Y1_SOYBN SoyBaseE_val: 7.00E-22ISS

Expression Patterns of Glyma09g37331
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g37331 not represented in the dataset
Glyma09g37331 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g37331 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g238700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g37331
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g37331
>Glyma09g37331.1   sequence type=CDS   gene model=Glyma09g37331   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGAGGAGATGCCCACACAATACAATACATCGCGAGTGCCGAAGGAATTATGCATGTAGGGTTGGAGGATATATTTTGGATGGCTGCAGGCAGTTCGTAGCAAGTGGTGCGGAGGGCACAGCTGCTGCTATGACTTGTGCTACATGTGGCTGCCACAAAAATTTTCACAGGAGGGAAGAGCTACCTCACGTAGTTTGTGGTTGCAATAATGAAGCTTGA
Predicted protein sequences of Glyma09g37331
>Glyma09g37331.1   sequence type=predicted peptide   gene model=Glyma09g37331   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPRRCPHNTIHRECRRNYACRVGGYILDGCRQFVASGAEGTAAAMTCATCGCHKNFHRREELPHVVCGCNNEA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo