SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma09g36966

Feature Type:gene_model
Chromosome:Gm09
Start:42540540
stop:42542742
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G66370AT Annotation by Michelle Graham. TAIR10: myb domain protein 113 | chr1:24753634-24754604 FORWARD LENGTH=246 SoyBaseE_val: 1.00E-55ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0031540GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_B6V7D2UniRef Annotation by Michelle Graham. Most informative UniRef hit: R2R3 MYB transcription factor n=1 Tax=Vitis vinifera RepID=B6V7D2_VITVI SoyBaseE_val: 2.00E-66ISS
UniRef100_UPI0002338463UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338463 related cluster n=1 Tax=unknown RepID=UPI0002338463 SoyBaseE_val: 1.00E-140ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g36966 not represented in the dataset

Glyma09g36966 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g234900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g36966.1   sequence type=CDS   gene model=Glyma09g36966   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGGATCATCAGGTGTAAGGAAAGGCGCATGGAGTCAAATTGAAGATAACCTTCTCAGAGATTGCGTGAACCTTCATGGGGAAGGAAAATGGCACCTTGTTCCTAAAAGAGCAGGGTTGAACAGATGCCGCAAGAGTTGTAGATTGAGATGGTTGAACTATCTTAAACCAAATATCAAGCGGGGAGATTTTAGTGAAGATGAGGTTGATTTGATGATCAGATTGCACAAGCTTTTGGGAAACAGATGGTCCCTAATTGCAGGGAGACTTCCAGGAAGAACTTCAAACGATGTGAAGAATTACTGGAACACCTACATGCGCCGTAAAGTACACTCTCACAAGAAAGACAACAACATAGAGAAGCAAGCTGATGAGGCCAAACCAATAGTGAAACATCACGAAGTTATAAAACCTGTTCCTCGAACTCTATCAAAAACATCTCCATGGTTGCAAGGGAAATTTGTTAATAGTTCCAAAGTTGGTGTTAGTGAAGAAGGTGCAACTTCAATATCAGGGTCTGCTGGGAATTGGTGGGAAACTTTGTTAGATGACAAAGAAGACAATGCAGTTAATAACAACAACACTTATAAGTTTACCTTTAGAAACAAACAACTAGTTTTTTAG

>Glyma09g36966.1   sequence type=predicted peptide   gene model=Glyma09g36966   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGSSGVRKGAWSQIEDNLLRDCVNLHGEGKWHLVPKRAGLNRCRKSCRLRWLNYLKPNIKRGDFSEDEVDLMIRLHKLLGNRWSLIAGRLPGRTSNDVKNYWNTYMRRKVHSHKKDNNIEKQADEAKPIVKHHEVIKPVPRTLSKTSPWLQGKFVNSSKVGVSEEGATSISGSAGNWWETLLDDKEDNAVNNNNTYKFTFRNKQLVF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo