SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g36731): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g36731): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g36731

Feature Type:gene_model
Chromosome:Gm09
Start:42388387
stop:42391120
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g36731
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G04600AT Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr5:1323700-1325486 FORWARD LENGTH=222 SoyBaseE_val: 2.00E-32ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0051604GO-bp Annotation by Michelle Graham. GO Biological Process: protein maturation SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
UniRef100_B9SY14UniRef Annotation by Michelle Graham. Most informative UniRef hit: Poly-A binding protein, putative n=1 Tax=Ricinus communis RepID=B9SY14_RICCO SoyBaseE_val: 5.00E-33ISS
UniRef100_I1JG14UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JG14_SOYBN SoyBaseE_val: 3.00E-47ISS

Expression Patterns of Glyma09g36731
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g36731 not represented in the dataset
Glyma09g36731 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g36731 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g36731
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g36731
>Glyma09g36731.1   sequence type=CDS   gene model=Glyma09g36731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGACCAAGGTAAAGAAAGCTATGAAGAATTTGAAAAGGGCAACTACTAATAAGCCATCCGAGGATGCTGACTTTTTGTCCTTGGAAGGTGGTCCTGTTTGCAAACAACCCGAACAGAAGCTGCTGAAGAATACTGCAACTGTTTTGTATGTGGGTAGGATTCCACATGGATTCTATGAGAAGGAGATGGAAGCATCGAGGGGATCAAGTGAATATGTGACTTTTTCCTTTATTGATGGAGAGGATTCGATTACCATCACAAGCCATTGGACTTGGTCCAAATTGAACGGAAGTGAAAGAACATTGGAAGAGCACATGAAGTTGGTGGAAAAGATTATGAAACATGACAAAAACCGACGTAAAAGGATAGAGGCTGCTGGCGTTGATTATGAATGCCCTGAGATTGTGGTTAACATTCAGCCTGCTCCAAAGAAAATGAAGTTTGAAGACTGA
Predicted protein sequences of Glyma09g36731
>Glyma09g36731.1   sequence type=predicted peptide   gene model=Glyma09g36731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTKVKKAMKNLKRATTNKPSEDADFLSLEGGPVCKQPEQKLLKNTATVLYVGRIPHGFYEKEMEASRGSSEYVTFSFIDGEDSITITSHWTWSKLNGSERTLEEHMKLVEKIMKHDKNRRKRIEAAGVDYECPEIVVNIQPAPKKMKFED*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo