Glyma09g36060 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g36060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g36060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g36060

Feature Type:	gene_model
Chromosome:	Gm09
Start:	41940173
stop:	41941086
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g36060

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G28420	AT	Annotation by Michelle Graham. TAIR10: Lactoylglutathione lyase / glyoxalase I family protein \| chr2:12157946-12158500 FORWARD LENGTH=184	SoyBase	E_val: 6.00E-47	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0016114	GO-bp	Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0019915	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid storage	SoyBase	N/A	ISS
GO:0050826	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to freezing	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004462	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lactoylglutathione lyase activity	SoyBase	N/A	ISS
KOG2944	KOG	Glyoxalase	JGI		ISS
PTHR10374	Panther	LACTOYLGLUTATHIONE LYASE	JGI		ISS
PTHR10374:SF0	Panther	LACTOYLGLUTATHIONE LYASE (GLYOXALASE I)	JGI		ISS
PF00903	PFAM	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily	JGI		ISS
UniRef100_B4UWB4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Lactoylglutathione lyase (Fragment) n=1 Tax=Arachis hypogaea RepID=B4UWB4_ARAHY	SoyBase	E_val: 5.00E-48	ISS
UniRef100_I1L5K2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1L5K2_SOYBN	SoyBase	E_val: 2.00E-70	ISS

Expression Patterns of Glyma09g36060

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g36060 not represented in the dataset	Glyma09g36060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g36060 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g226500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g36060

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g36060

Limit To All Plant Sequences

>Glyma09g36060.2   sequence type=CDS   gene model=Glyma09g36060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGGAAGGAAAAGGAAAGGAGGAAAACCCACCTCCATTATTGGCAATGAACCACGTTTCAAGGTTGTGTAGGAATGTGAAGGAATCCATAGATTTCTACACAAAGGTGCTGGGATTTGTTCTGATTGAGAGGCCCCAAGCTTTGGACTTTGAGGGTGCATGGTTGTTCAATTATGGAGTTGGTATCCACTTGTGTGAAGATCTGGAAGCAATGGAGAAAAAGTTGAAGGAGAAGAATGTGAAGTACATGAAAAGGACTCTGGAGAGAGAAGATGGAACGACAATGGATCAAATTTTCTTCAATGACCCAGATGGGTTCATGGTGGAGATATGA

Predicted protein sequences of Glyma09g36060

Limit To All Plant Sequences

>Glyma09g36060.2   sequence type=predicted peptide   gene model=Glyma09g36060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KEGKGKEENPPPLLAMNHVSRLCRNVKESIDFYTKVLGFVLIERPQALDFEGAWLFNYGVGIHLCEDLEAMEKKLKEKNVKYMKRTLEREDGTTMDQIFFNDPDGFMVEI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain