Glyma09g35810 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g35810): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g35810): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g35810

Feature Type:	gene_model
Chromosome:	Gm09
Start:	41714335
stop:	41715409
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g35810

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G47430	AT	Annotation by Michelle Graham. TAIR10: peroxin 11B \| chr3:17480798-17481692 FORWARD LENGTH=227	SoyBase	E_val: 1.00E-113	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0007031	GO-bp	Annotation by Michelle Graham. GO Biological Process: peroxisome organization	SoyBase	N/A	ISS
GO:0016559	GO-bp	Annotation by Michelle Graham. GO Biological Process: peroxisome fission	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0005778	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisomal membrane	SoyBase	N/A	ISS
GO:0005779	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to peroxisomal membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0042802	GO-mf	Annotation by Michelle Graham. GO Molecular Function: identical protein binding	SoyBase	N/A	ISS
KOG4186	KOG	Peroxisomal biogenesis protein (peroxin)	JGI		ISS
PTHR12652	Panther	PEROXISOMAL BIOGENESIS FACTOR 11	JGI		ISS
PF05648	PFAM	Peroxisomal biogenesis factor 11 (PEX11)	JGI		ISS
UniRef100_B9R9T1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal biogenesis factor, putative n=1 Tax=Ricinus communis RepID=B9R9T1_RICCO	SoyBase	E_val: 2.00E-132	ISS
UniRef100_I1L5H9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L5H9_SOYBN	SoyBase	E_val: 2.00E-160	ISS

Expression Patterns of Glyma09g35810

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g35810 not represented in the dataset	Glyma09g35810 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g35810

Paralog	Evidence	Comments
Glyma12g01540	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g35810 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g224200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g35810

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g35810

Limit To All Plant Sequences

>Glyma09g35810.1   sequence type=CDS   gene model=Glyma09g35810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGACTCAGTGGACAAACTGGTAATCTTCCTAGCAAAGAGAGATGGCATAGACAAGGTGGTGAAGACGTTCCAGTACGTGTCAAAGCTCGTAAACTGGCACGTGGAAGGCACGCAGGCGGACATATCGAGGAGGTTCAAGCAATGGGAAGTGGCCTCAGGGCTCAGCAGAAAAGCCTTCAGAACTGGAAGGTTCCTCAGCGGCTTCAACGTTCTTCGCAGAAACCCAGGCTCCACCCTTTCTCTTAGGCTACTAGCGGTGCTCGCAAATGCAGGGGAAATGGTGTATTTCTTCTTCGATCACTTTCTTTGGTTGGCAAGGATTGGGACCATAGACGCAAGCTTGGCGAAGAAGATGAGCTTCATATCCGCGTTTGGTGAGTCTGTTGGGTATGTCTTCTTCATCATAGCTGATTTTATTATGCTCAAAGAAGGGATCAAGGCACAGAGAGAGCTGAGCAGCTCCAAGGAGGAAGAGATCAAAATAGGGATTCAGAAGATCAGAAGCGATAGAATCATGAGGCTAATGGCAGTGGCTGCTAATGTTGCGGATTTGTTCATAGCAATAGCGGAGATTGAGCCAAACCCTTTCTGCAACCACACTGTTACGCTTGGTATTAGTGGCTTGGTTTCTGCTTGGGCTGGTTGGTATAGAAATTGGCCTTCATAA

Predicted protein sequences of Glyma09g35810

Limit To All Plant Sequences

>Glyma09g35810.1   sequence type=predicted peptide   gene model=Glyma09g35810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNDSVDKLVIFLAKRDGIDKVVKTFQYVSKLVNWHVEGTQADISRRFKQWEVASGLSRKAFRTGRFLSGFNVLRRNPGSTLSLRLLAVLANAGEMVYFFFDHFLWLARIGTIDASLAKKMSFISAFGESVGYVFFIIADFIMLKEGIKAQRELSSSKEEEIKIGIQKIRSDRIMRLMAVAANVADLFIAIAEIEPNPFCNHTVTLGISGLVSAWAGWYRNWPS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain