SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g35780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g35780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g35780

Feature Type:gene_model
Chromosome:Gm09
Start:41691711
stop:41695789
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G10110AT Annotation by Michelle Graham. TAIR10: Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein | chr3:3116225-3117378 FORWARD LENGTH=173 SoyBaseE_val: 4.00E-69ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005744GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane presequence translocase complex SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
KOG3225 KOG Mitochondrial import inner membrane translocase, subunit TIM22 JGI ISS
PTHR14110Panther TRANSLOCASE OF INNER MITOCHONDRIAL MEMBRANE TIM22 JGI ISS
PF02466PFAM Tim17/Tim22/Tim23 family JGI ISS
UniRef100_G7JSS1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit TIM22 n=1 Tax=Medicago truncatula RepID=G7JSS1_MEDTR SoyBaseE_val: 2.00E-103ISS
UniRef100_I1L5H5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L5H5_SOYBN SoyBaseE_val: 8.00E-121ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g35780 not represented in the dataset

Glyma09g35780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g223900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g35780.1   sequence type=CDS   gene model=Glyma09g35780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGATGACTCTGCTAAAGGAATTGAAAATGCTTCTTTGAACTCAACACGACTAGAGAACCCTCAGATTGAGCCCATAAGACTGCCCTCGGTAGAGGAAATCCGTGGTCAAGACATTTGGAACAATTGTGCAGTGCGCAGTGTTGTCAGTGGAGTCATGGGTGGCGGGCTTGGCATCTTCATGGGTTTATTTCTTGGAGCACTGGACAACCCATTGATGCAGGAGGAAATGACCGGCAGACAACAGCTTATATATCAAGCAAAACAGATGGGGCGAAGGAGTTGGAGTTCAGCCAAAGCATTTGCTGTTATGGGTTTCATATTCTCAGCTGCCGAGTGTGTTGTTGAGAAGGCTCGAGCAAAACATGACATAACAAATACCGTTGTTGCTGGATGTGCAACTGGAGGTGCAATATCAGCAAAAGGTGGCCCAAAAGCAGCGTGTGCTGGTTGTGCTGGCTTTGCGGCATTCTCAGTCGTAATAGAGAAGTTTTTGGAGAGACATCAATAA

>Glyma09g35780.1   sequence type=predicted peptide   gene model=Glyma09g35780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADDSAKGIENASLNSTRLENPQIEPIRLPSVEEIRGQDIWNNCAVRSVVSGVMGGGLGIFMGLFLGALDNPLMQEEMTGRQQLIYQAKQMGRRSWSSAKAFAVMGFIFSAAECVVEKARAKHDITNTVVAGCATGGAISAKGGPKAACAGCAGFAAFSVVIEKFLERHQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo