|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G38840 | AT | Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr4:18125174-18125473 REVERSE LENGTH=99 | SoyBase | E_val: 1.00E-33 | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF02519 | PFAM | Auxin responsive protein | JGI | ISS | |
| UniRef100_G7JL22 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 6B n=1 Tax=Medicago truncatula RepID=G7JL22_MEDTR | SoyBase | E_val: 3.00E-47 | ISS |
| UniRef100_I1L5F2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L5F2_SOYBN | SoyBase | E_val: 5.00E-62 | ISS |
|
Glyma09g35550 not represented in the dataset |
Glyma09g35550 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g221500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g35550.1 sequence type=CDS gene model=Glyma09g35550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGTTTTCGTCTACCCGCAAGTATCAGAAGGGCATCATTTGCTGCCAACCAAGCATCTTCAAAAACTTTGGAGGTGCCAAAGGGCTATCTTGCAGTCTATGTTGGAGAGAGAATGAAGCGGTTTGTGATCCCCATATCATACTTGACCCAACCTTCATTCCAAGAATTGTTGAATCAAGCTGAGGAAGAGTTTGGATATGATCATCCCATGGGTGGTCTTACAATTCCTTGCAGCGAAGATGTCTTCCAAAACATAACTTCACGCTTGGTTGGGCTGTAA
>Glyma09g35550.1 sequence type=predicted peptide gene model=Glyma09g35550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGFRLPASIRRASFAANQASSKTLEVPKGYLAVYVGERMKRFVIPISYLTQPSFQELLNQAEEEFGYDHPMGGLTIPCSEDVFQNITSRLVGL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||