SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g35260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g35260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g35260

Feature Type:gene_model
Chromosome:Gm09
Start:41481333
stop:41482924
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G16800AT Annotation by Michelle Graham. TAIR10: high-affinity nickel-transport family protein | chr2:7285824-7287188 FORWARD LENGTH=372 SoyBaseE_val: 4.00E-141ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0015675GO-bp Annotation by Michelle Graham. GO Biological Process: nickel cation transport SoyBaseN/AISS
GO:0030001GO-bp Annotation by Michelle Graham. GO Biological Process: metal ion transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0015099GO-mf Annotation by Michelle Graham. GO Molecular Function: nickel cation transmembrane transporter activity SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PF03824PFAM High-affinity nickel-transport protein JGI ISS
UniRef100_B9T4M0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Urease accessory protein ureH, putative n=1 Tax=Ricinus communis RepID=B9T4M0_RICCO SoyBaseE_val: 2.00E-155ISS
UniRef100_UPI0002338168UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338168 related cluster n=1 Tax=unknown RepID=UPI0002338168 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g35260 not represented in the dataset

Glyma09g35260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g03750 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g218700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g35260.2   sequence type=CDS   gene model=Glyma09g35260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CATGAAACCCCACCCCCTCCATTATCCTATTCTCCTCCCAAAACCCTACCATCCCTTATCCCCTCTCCGTCTCCGCTCACTCCGAATCATTTCCAAAAACCACCAAAGGCAATAACAGCCCGAACATTTGCAATACTCTCTGCTCTTGTTTTGCTCTTAATCCAACCAGCTTTTGCTCCTGCAGCTTTTGCAACGTTTCAAAATGCTGCCAAGACCAGTGGCCCTGCTGCTGCAGCAGTTGGTGGAAAACTAATCCGCACTGAGCTTCTAAGTAGTGCTTGGACTGGTTTCTTTGCCGGTTGCTTGCACACACTATCAGGGCCTGACCACCTTGCAGCTTTGGCTCCATTGTCAATTGGCCGAACCCAAATGGAGAGTGCTGCTGTTGGAGCCCTTTGGGGTTGTGGCCATGATGCCGGTCAAGTTATCTTTGGCTTAATATTTTTGCTCTTAAAAGATCGACTTCACATTGAAATTATCCAAACTTGGGGCACCCGTGTGGTTGGCCTTACCCTGCTAGTAATTGGTGCTATGGGAATTAAGGAAGCTTCAGAAGTGCCTATCCTGTGTGTTGCCTTAGAAAATGGTGAATGTGATGTTAGCGTCTATGAATCACGCGATAGTAATCCTGTTGTAGGAAAGAAGAAGATTGGTTTTGCTACTTTTGCCACTGGAATAGTTCATGGACTGGAACCAGATGCATTGATGATGGTGTTGCCTGCCCTTGCTCTACCTTCACGCTTGGCTGGTGCTGCATTTCTCATCATGTTCTTACTGGGAACTGTTGTTGCAATGGGGAGCTATACGGTATTTATTGGTTCATGTAGCGAGGCACTAAAAGATAGAGTACCTAGAATAACTGAGAAACTCACTTGGGCTTCTTCTCTTGTTGCAATAGCCCTCGGATTTGCCATCATCACTAGCCAGTTTTTTGGGTTTAGCCTGTATTAG

>Glyma09g35260.2   sequence type=predicted peptide   gene model=Glyma09g35260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
HETPPPPLSYSPPKTLPSLIPSPSPLTPNHFQKPPKAITARTFAILSALVLLLIQPAFAPAAFATFQNAAKTSGPAAAAVGGKLIRTELLSSAWTGFFAGCLHTLSGPDHLAALAPLSIGRTQMESAAVGALWGCGHDAGQVIFGLIFLLLKDRLHIEIIQTWGTRVVGLTLLVIGAMGIKEASEVPILCVALENGECDVSVYESRDSNPVVGKKKIGFATFATGIVHGLEPDALMMVLPALALPSRLAGAAFLIMFLLGTVVAMGSYTVFIGSCSEALKDRVPRITEKLTWASSLVAIALGFAIITSQFFGFSLY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo