SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g34770

Feature Type:gene_model
Chromosome:Gm09
Start:41065135
stop:41067242
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g34770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G31812AT Annotation by Michelle Graham. TAIR10: acyl-CoA-binding protein 6 | chr1:11411132-11412099 REVERSE LENGTH=92 SoyBaseE_val: 9.00E-44ISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000062GO-mf Annotation by Michelle Graham. GO Molecular Function: fatty-acyl-CoA binding SoyBaseN/AISS
GO:0031210GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylcholine binding SoyBaseN/AISS
PTHR23310Panther ACYL-COA-BINDING PROTEIN, ACBP JGI ISS
PTHR23310:SF10Panther ACYL COA BINDING PROTEIN JGI ISS
PF00887PFAM Acyl CoA binding protein JGI ISS
UniRef100_C6SXV7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXV7_SOYBN SoyBaseE_val: 5.00E-59ISS
UniRef100_F4YFC6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acyl-CoA-binding protein n=1 Tax=Camellia sinensis RepID=F4YFC6_CAMSI SoyBaseE_val: 3.00E-48ISS

Expression Patterns of Glyma09g34770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g34770
ParalogEvidenceComments
Glyma04g14650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g34770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g214500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g34770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g34770
>Glyma09g34770.1   sequence type=CDS   gene model=Glyma09g34770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTGAAGGAGGATTTTGAGCAGTATGCTGAGAAAGCAAAAACTTTGCCACCGACTCAATCAAACGAAGACTTGCTTATCCTTTATGGATTGTACAAACAGGCCACCGTTGGACCTGTCAACACCAGCCGTCCTGGAATGTTCAACATGAGGGACAGAGCTAAATGGGATGCATGGAAGGCTGTTGAAGGGAAATCCAAGGACGAAGCAATGGGTGATTACATCATTAAGGTGAAACAGCTGCTGGAAGCAGCTGGCTTGCCTGCTTGA
Predicted protein sequences of Glyma09g34770
>Glyma09g34770.1   sequence type=predicted peptide   gene model=Glyma09g34770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLKEDFEQYAEKAKTLPPTQSNEDLLILYGLYKQATVGPVNTSRPGMFNMRDRAKWDAWKAVEGKSKDEAMGDYIIKVKQLLEAAGLPA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo