Glyma09g34710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g34710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g34710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g34710

Feature Type:	gene_model
Chromosome:	Gm09
Start:	41024182
stop:	41028234
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g34710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G45390	AT	Annotation by Michelle Graham. TAIR10: CLP protease P4 \| chr5:18396351-18397586 FORWARD LENGTH=292	SoyBase	E_val: 4.00E-138	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0009658	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast organization	SoyBase	N/A	ISS
GO:0009902	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast relocation	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0034660	GO-bp	Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0042793	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0048510	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009532	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid stroma	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplastic endopeptidase Clp complex	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0004252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity	SoyBase	N/A	ISS
KOG0840	KOG	ATP-dependent Clp protease, proteolytic subunit	JGI		ISS
PTHR10381	Panther	PROTEASE FAMILY S14 CLPP PROTEASE	JGI		ISS
PF00574	PFAM	Clp protease	JGI		ISS
UniRef100_I1L564	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent Clp protease proteolytic subunit n=1 Tax=Glycine max RepID=I1L564_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1L564	UniRef	Annotation by Michelle Graham. Best UniRef hit: ATP-dependent Clp protease proteolytic subunit n=1 Tax=Glycine max RepID=I1L564_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma09g34710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g34710 not represented in the dataset	Glyma09g34710 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g34710

Paralog	Evidence	Comments
Glyma01g35280	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g34710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g213800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g34710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g34710

Limit To All Plant Sequences

>Glyma09g34710.1   sequence type=CDS   gene model=Glyma09g34710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTGCTCTCAATCTCTCCCTCTCACCCTTTACCTTCTTCCATTCGAACCCTTTCCTCAAACCCTAAGCCACCCATTTCCTCCTCCTTCTTCTTCATCCCCAAACCCCATTCACGCTTCTCCAAAACCCCACCAAGGTGCGTCTTCACGCCGGCCTCGCCAATCCCCTCCAAAAACCCAAACTTTGGGTCCCAGTCTCGGAACCCTACGAGCCTCACCTTCGAGCTCTCCTCGCCCCAGACTCCCTCGACGGCGGCGAGAGGCGCGGAGGGCGACGTGATGGGGCTGTTGCTGAGAGAGAGGATTGTGTTCCTCGGGAGCAGCATCGATGACTTTGTGGCCGATGCTATCATGAGCCAGATGCTGCTGTTGGATGCCCAAGACCCCACTAAGGATATCAGGCTCTTCATTAATTCCACTGGTGGCTCTCTCAGTGCTACAATGGCTATCTATGATGCCGTACAGCTTGTGAGGGCCGATGTTTCCACAGTTGCACTCGGCATTGCAGCATCAACAGCTTCTGTTATCCTTGGTGGTGGCACCAAAGGCAAGCGCTTTGCTATGCCAAATACACGAATTATGATTCATCAACCTCTAGGAGGTGCTAGTGGACAAGCTATAGATGTAGAAATTCAGGCTAAAGAAGTTATGCACAACAAGAATAATATCACAAGAATTATATCAAGTTTCACTGGACGCTCATTTGAACAAGTGCAAAAAGATATTGATAGGGATAAATATATGTCTCCAATTGAAGCAGTGGAATACGGAATTATTGATGGTGTAATCGATAGAGATAGCATTATTCCTCTCATGCCAGTGCCAGAAAGGGTGAAATCAACCCTAAACTATGAAGAAATAAGTAAAGATCCCAGGAAATTCCTAACCCCAGATATTCCTGATGATGAGATATACTAG

Predicted protein sequences of Glyma09g34710

Limit To All Plant Sequences

>Glyma09g34710.1   sequence type=predicted peptide   gene model=Glyma09g34710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLLSISPSHPLPSSIRTLSSNPKPPISSSFFFIPKPHSRFSKTPPRCVFTPASPIPSKNPNFGSQSRNPTSLTFELSSPQTPSTAARGAEGDVMGLLLRERIVFLGSSIDDFVADAIMSQMLLLDAQDPTKDIRLFINSTGGSLSATMAIYDAVQLVRADVSTVALGIAASTASVILGGGTKGKRFAMPNTRIMIHQPLGGASGQAIDVEIQAKEVMHNKNNITRIISSFTGRSFEQVQKDIDRDKYMSPIEAVEYGIIDGVIDRDSIIPLMPVPERVKSTLNYEEISKDPRKFLTPDIPDDEIY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain