SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g34400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g34400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g34400

Feature Type:gene_model
Chromosome:Gm09
Start:40781500
stop:40787428
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32050AT Annotation by Michelle Graham. TAIR10: SCAMP family protein | chr1:11528616-11530974 FORWARD LENGTH=264 SoyBaseE_val: 3.00E-150ISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0022857GO-mf Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity SoyBaseN/AISS
KOG3088 KOG Secretory carrier membrane protein JGI ISS
PTHR10687Panther SECRETORY CARRIER MEMBRANE PROTEIN JGI ISS
PTHR10687:SF2Panther gb def: m01d7.2.p [caenorhabditis elegans] JGI ISS
PF04144PFAM SCAMP family JGI ISS
UniRef100_C6TC38UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TC38_SOYBN SoyBaseE_val: 0ISS
UniRef100_G7K9I4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Secretory carrier-associated membrane protein n=1 Tax=Medicago truncatula RepID=G7K9I4_MEDTR SoyBaseE_val: 9.00E-174ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g34400 not represented in the dataset

Glyma09g34400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g01380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g210800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g34400.1   sequence type=CDS   gene model=Glyma09g34400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCGCCACAACGATCCCAATCCTTTCGAGGAAGAAGAAGTCAATCCTTTTTCGAATGGTGGTGCTGCTCCTGCATCCAAATCACGTATTCCACCATTAGCATCTCAGCCACTGGGCTTTGGTCAAAGGCATGATGCTACAGTTGATATTCCTTTGGATACTACAAATGACTCCAAGAAAAGAGGTCAAGAGCTAGCTGCTTGGGAAGCGGATTTAAAACGGAAAGAGAAGGAAATAAAAAGAAGAGAAGAGGCTGTTTCTAGAGCTGGTGTTCCTGTTGATGATAAGAATTGGCCTCCAATTTTCCCAATCATTCATCATGATATTGCCAATGAGATACCGGTTCATGCTCAGAGGCTGCAATATTTGGCCTTTGCAAGTTGGTTAGGAATTGTTCTCTGCCTAGTTTTTAATGTAGTTGCTGTGACTGTCTGTTGGATCAGAGGCGGCGGTGTTAAAATTTTTTTCCTTGCGGTTATATATGGTCTACTTGGTGTTCCCCTTTCATATGTTCTTTGGTACAGACCCCTCTATCGTGCTATGAGGACGGATAGTGCACTGAAGTTTGGTTGGTTTTTCATGTTCTACTTGCTTCATATTGGATTTTGCATCTTTGCTGCAATTGCGCCTCCAATTGTTTTTCATGGAAAATCATTAACGGGCATCCTTGCTGCAATTGATGTCTTCTCAGACCATGTATTGGTTGGGATATTCTATTTGATTGGATTTGGCATGTTTTGCTTGGAGGCTCTTCTAAGCTTATGGGTGCTTCAGAAAATATACATGTACTTCCGGGGGCATAAGTGA

>Glyma09g34400.1   sequence type=predicted peptide   gene model=Glyma09g34400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNRHNDPNPFEEEEVNPFSNGGAAPASKSRIPPLASQPLGFGQRHDATVDIPLDTTNDSKKRGQELAAWEADLKRKEKEIKRREEAVSRAGVPVDDKNWPPIFPIIHHDIANEIPVHAQRLQYLAFASWLGIVLCLVFNVVAVTVCWIRGGGVKIFFLAVIYGLLGVPLSYVLWYRPLYRAMRTDSALKFGWFFMFYLLHIGFCIFAAIAPPIVFHGKSLTGILAAIDVFSDHVLVGIFYLIGFGMFCLEALLSLWVLQKIYMYFRGHK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo