SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g33430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g33430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g33430

Feature Type:gene_model
Chromosome:Gm09
Start:39898411
stop:39899097
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G42005AT Annotation by Michelle Graham. TAIR10: Transmembrane amino acid transporter family protein | chr2:17531323-17532564 REVERSE LENGTH=413 SoyBaseE_val: 2.00E-43ISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005275GO-mf Annotation by Michelle Graham. GO Molecular Function: amine transmembrane transporter activity SoyBaseN/AISS
PTHR22950Panther AMINO ACID TRANSPORTER JGI ISS
PF01490PFAM Transmembrane amino acid transporter protein JGI ISS
UniRef100_B9SMC5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Amino acid transporter, putative n=1 Tax=Ricinus communis RepID=B9SMC5_RICCO SoyBaseE_val: 6.00E-49ISS
UniRef100_UPI00023373BEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023373BE related cluster n=1 Tax=unknown RepID=UPI00023373BE SoyBaseE_val: 2.00E-53ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g33430 not represented in the dataset

Glyma09g33430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g33430.1   sequence type=CDS   gene model=Glyma09g33430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTAACTCCTTCACCGACTTCTCTAAAATCTCCTCCTTTGACGACCTCGGCTTCATCATTTGCGGCTCAATGGGCCACATTGCTGTCGACGTCATGATCAACAAGCCCCATTTGAAAGTATTTGGGGGTTTGTCGGTGTTTTTCTATGACATAGGTGTGGCAGTGTATGCTTTTGAAGGAATTGGAATGGTTTTACCTTTGGAAACTAAGGTGAAGGATAAGCAGAGGTTCGGTAGGGTTTTGGGTTTGGGGATGAGTTCGATTTCACTTTTGGGGGAAGAAACTAAGGATATTATTACCACTAATTTGGGGCCTCGGGTGATTAGTGTGTTGGTTCAGTTGGGGTCTGGGATGAACCTGGTGAATGAGGTGATGGAGAGACGGTTCTACGGGTCAAGGTATTGCTTGTGGCCGAGGTGGGTGATGGAGTTGGTCATAAGCTTGGTGGCGCTTTTGGTGCCCAATTTTTGTGGATTTTTTGTCCCTTGTGGAAGCAATTCTAACATATAT

>Glyma09g33430.1   sequence type=predicted peptide   gene model=Glyma09g33430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LNSFTDFSKISSFDDLGFIICGSMGHIAVDVMINKPHLKVFGGLSVFFYDIGVAVYAFEGIGMVLPLETKVKDKQRFGRVLGLGMSSISLLGEETKDIITTNLGPRVISVLVQLGSGMNLVNEVMERRFYGSRYCLWPRWVMELVISLVALLVPNFCGFFVPCGSNSNIY







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo