|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATMG00640 | AT | Annotation by Michelle Graham. TAIR10: hydrogen ion transporting ATP synthases, rotational mechanism;zinc ion binding | chrM:188084-188662 REVERSE LENGTH=192 | SoyBase | E_val: 9.00E-36 | ISS |
GO:0015986 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport | SoyBase | N/A | ISS |
GO:0000276 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0005753 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
GO:0015078 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity | SoyBase | N/A | ISS |
GO:0046933 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism | SoyBase | N/A | ISS |
PF05405 | PFAM | Mitochondrial ATP synthase B chain precursor (ATP-synt B) | JGI | ISS | |
UniRef100_I1TIB9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: ATPase subunit 4 n=2 Tax=Daucus carota RepID=I1TIB9_DAUCA | SoyBase | E_val: 3.00E-39 | ISS |
UniRef100_I1TIB9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATPase subunit 4 n=2 Tax=Daucus carota RepID=I1TIB9_DAUCA | SoyBase | E_val: 3.00E-39 | ISS |
Glyma09g33055 not represented in the dataset |
Glyma09g33055 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.09g198100 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g33055.1 sequence type=CDS gene model=Glyma09g33055 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAACTAAGGATTTTTCAAACGGATATGCAAGCTAGAAATATGCTATTTGCTGCTATTCCATCTATTTATGCATTAAGTTTGAAGAAGATCTCAATCTATAATGAAGAAATGATAGTAGCTCGTTGTTTTATAGGCTTCATCATATTCATTCGGAAGAGTTTAGGTAAGACTTTCAAAGTGACTCTCGACGGGAGAATCCATGCTATTCAAGGAGAATCGCAGCAATTCCCCAATCCTAACGAAGATTATTGTCGAATCACATTTGCTAACATGCATTTGAATCCTACACCTCCCATTTTATGCGTGTGA
>Glyma09g33055.1 sequence type=predicted peptide gene model=Glyma09g33055 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKLRIFQTDMQARNMLFAAIPSIYALSLKKISIYNEEMIVARCFIGFIIFIRKSLGKTFKVTLDGRIHAIQGESQQFPNPNEDYCRITFANMHLNPTPPILCV*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||